DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and AT5G42320

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:406 Identity:96/406 - (23%)
Similarity:151/406 - (37%) Gaps:112/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LSP---ELIDANAQTSLSLDIEPIADANRRSDDYSWSEYHELNDTHRWMQNLVGKYPDVVSVFVA 145
            |||   .|:......|.|..:.||          :|..||..:|....:.:||.::||.:|:.:.
plant    17 LSPLLLLLVLGETNPSDSSFVTPI----------NWDLYHSSDDLMEQIHSLVHRHPDKLSIELI 71

  Fly   146 GQSYEGRELLGLRIN---------HNDGRAEKQSIFLEAGMHAREWIGPATATYFANELLSSQQQ 201
            ....:|   ....:|         .:|.|:..: |.|..|.|.||.|    .:..|..:||...:
plant    72 KSGNKG---YNAEVNVVTYCRGGKESDDRSNFR-ILLTFGQHGRELI----TSELAFRILSILSE 128

  Fly   202 E----------IMNLARSYVWYILPHANPDGYVYTHKTNRMWRKTRSPQD----KNCVGTDPNRN 252
            |          :.|.....|..::|..||:|           ||.....|    :|..|.|.|||
plant   129 EQFLPNKNGGILKNTLDKLVIKMVPIENPNG-----------RKRVESGDLCERRNGRGVDLNRN 182

  Fly   253 WDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLKSVPEPMFMFLSLHSFSQLLLYPYGHTS 317
            |...|.:.....|| ||...|...|||||.|.:.:...|. :| .:::::||..:.|..||.|.:
plant   183 WGVDWGKKEKDYDP-SEENPGTAPFSEPETQIMRKLAISF-DP-HIWINVHSGMEALFMPYDHKN 244

  Fly   318 ALPE-----NHRQLEQIFN-------TAVGAMKRRYGTRYTGGNVYDAIYPAAGSSMDWAYGVLN 370
            ..||     ..|.|.:..|       ..:|:         .||:|.   |.|.|::.|:.|.|:.
plant   245 ITPEGLPSQKMRTLLEKLNKFHCHDRCMIGS---------GGGSVG---YLAHGTATDYIYDVVK 297

  Fly   371 VKYSFTYE---------------------------LRPSGYSFWTGFRLPAAQIIPTGQETTDSL 408
            ...:||:|                           |.....:|:|.|:|....:.....:..|..
plant   298 APMAFTFEIYGDNQTASRDCFKMFNPVDLPNFKRVLNDWSAAFFTIFQLGPLHLDGNTSKAADKW 362

  Fly   409 VEMIKAAAQIEGYKIE 424
            |.:.:   .::||.:|
plant   363 VSIDE---YLDGYLVE 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416 4/15 (27%)
M14_CP_A-B_like 119..415 CDD:199844 84/357 (24%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.