DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and AGBL2

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:240 Identity:47/240 - (19%)
Similarity:78/240 - (32%) Gaps:86/240 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 AEKQSIFLEAGMHAREWIGPATATYFANELLSSQQQEIMNLARSYVWYILPHANPDGYVYTHKTN 230
            |.|:::.|.|.:|..|..|......|.:.:||: ..:...|...:|:.:||..||||.:.     
Human   450 AAKKAVVLSARVHPGESNGSWVMKGFLDFILSN-SPDAQLLRDIFVFKVLPMLNPDGVIV----- 508

  Fly   231 RMWRKTRSPQDKNC--VGTDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLKSVP 293
                     .:..|  .|.|.||    |::.:...|.||              :......:|.:.
Human   509 ---------GNYRCSLAGRDLNR----HYKTILKESFPC--------------IWYTRNMIKRLL 546

  Fly   294 EPMFMFLSLHSFSQLLLYPYGHTSALPENHRQLEQIFNTAVGAMKRRYGTRYTGGNVYDAIYP-- 356
            |.          .::|||...|      .|.:...||........|:|.       :::.::|  
Human   547 EE----------REVLLYCDFH------GHSRKNNIFLYGCNNNNRKYW-------LHERVFPLM 588

  Fly   357 -----------------------AAGSSMDWAYGVLNVKYSFTYE 378
                                   ..|..:.|..|:||   |:|.|
Human   589 LCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWRMGILN---SYTME 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 47/240 (20%)
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117 47/240 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.