DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and Agbl3

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:274 Identity:50/274 - (18%)
Similarity:88/274 - (32%) Gaps:84/274 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 AEKQSIFLEAGMHARE----WIGPATATYFANELLSSQQQEIMNLARSYVWYILPHANPDGYVYT 226
            ::::::.|.|.:|..|    ||......|...:     ..:...|..::::.::|..||||.:. 
Mouse   356 SKRKAVILTARVHPGETNSSWIMKGFLDYILGD-----SSDARLLRDTFIFKVVPMLNPDGVIV- 414

  Fly   227 HKTNRMWRKTRSPQDKNC--VGTDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFL 289
                         .:..|  .|.|.|||:....:|                  |.|.|......:
Mouse   415 -------------GNYRCSLAGRDLNRNYTSLLKE------------------SFPSVWYTRNMI 448

  Fly   290 KSVPE--PMFMFLSLHSFSQ---LLLYPYGHTSALPENHRQLEQ-------------IFNTAV-- 334
            ..:.|  .:.::..||..|:   :.:|....:|........|:|             ||:.:.  
Mouse   449 NRLMEKREVILYCDLHGHSRKQNIFMYGCDGSSRSKTKGLYLQQRIFPLMLSKNCPNIFSFSACK 513

  Fly   335 -GAMKRRYGTRYTGGNVYDAIYPAAGSSMDWAYGVLNVKYSFTYELRPSGYSFWT--GFRLPAAQ 396
             ...|.:.||               |..:.|..|:.|   |||.|....|.:...  |.......
Mouse   514 FNVQKSKEGT---------------GRVVMWKMGIRN---SFTLEATFCGSTLGNKRGTHFGTKD 560

  Fly   397 IIPTGQETTDSLVE 410
            :...|....|||::
Mouse   561 LESMGYHFCDSLLD 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 50/274 (18%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 50/274 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.