DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and AGBL5

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_068603.4 Gene:AGBL5 / 60509 HGNCID:26147 Length:886 Species:Homo sapiens


Alignment Length:395 Identity:71/395 - (17%)
Similarity:120/395 - (30%) Gaps:167/395 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 YSWSEYHELNDTHRWMQNLVGKYP----------DVVSVFVAGQSYEGRELL-----GLRIN--- 160
            :|:|:..||      :..|..::|          |.:        |..||||     |||::   
Human   159 FSYSDCQEL------LNQLDQRFPENHPTHSSPLDTI--------YYHRELLCYSLDGLRVDLLT 209

  Fly   161 ---------HNDGRAE----------------KQSIFLEAGMHAREWIGPATATYFANELLSSQQ 200
                     ..:.|.|                |:..||.:.:|..|.........|.:.:|....
Human   210 ITSCHGLREDREPRLEQLFPDTSTPRPFRFAGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDD 274

  Fly   201 QEIMNLARSYVWYILPHANPDGYVYTH--------KTNRMWRK---------------------- 235
            .....|.|.:|:.::|..||||.|..|        ..||.:.|                      
Human   275 PRAQTLRRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVH 339

  Fly   236 -------TRSPQDKNCVGTDP-----------------NRNWDFH----WREVGASSDPCSESYA 272
                   :...|..:|:..|.                 ..:.|.|    |::...:....:..:.
Human   340 SRLNSQSSSEHQPSSCLPPDAPVSDLEKANNLQNEAQCGHSADRHNAEAWKQTEPAEQKLNSVWI 404

  Fly   273 GPKAFSEPEVQTLSQFLKSVPEP-------MFMFLSLHSF-SQLLLYPYGHTSALPENHRQLEQI 329
            .|:..:..|        :|.|:.       :..::.||.. |:...:.||  ::..:...|:|.:
Human   405 MPQQSAGLE--------ESAPDTIPPKESGVAYYVDLHGHASKRGCFMYG--NSFSDESTQVENM 459

  Fly   330 -------FNTA-------------VGAMKRRYGTRYTG-GNVYDAIYPAAGSSMDWAYGVLNVKY 373
                   .|:|             :.|..||.|....| |.|  |||.|:|           :.:
Human   460 LYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRV--AIYKASG-----------IIH 511

  Fly   374 SFTYE 378
            |:|.|
Human   512 SYTLE 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 69/390 (18%)
AGBL5NP_068603.4 M14_AGBL5_like 176..568 CDD:199860 66/372 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..364 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 605..734
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 784..848
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.