DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and agbl2

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_017209580.1 Gene:agbl2 / 568152 ZFINID:ZDB-GENE-070719-6 Length:1025 Species:Danio rerio


Alignment Length:105 Identity:27/105 - (25%)
Similarity:42/105 - (40%) Gaps:21/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 RAEKQSIFLEAGMHAREWIGPATATYFANELLSSQQQEIMNLARSYVWYILPHANPDGYVYTHKT 229
            |..|:::.:.|.:|..|..|......|. |.|.|...:...|..::::.::|..||||.|.    
Zfish   387 RKAKRAVVVTARVHPGETNGSWMMQGFL-EFLLSDLPDAHLLRETFIFKVIPMLNPDGVVV---- 446

  Fly   230 NRMWRKTRSPQDKNC--VGTDPNRNWDFHWREVGASSDPC 267
                      .:..|  .|.|.|||    :|.:...|.||
Zfish   447 ----------GNYRCSLAGRDLNRN----YRSMLRDSFPC 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 27/105 (26%)
agbl2XP_017209580.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.