DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and cpb1

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_031758320.1 Gene:cpb1 / 496994 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis


Alignment Length:435 Identity:152/435 - (34%)
Similarity:228/435 - (52%) Gaps:68/435 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLLLLLSVNILIFCLAERQRFDNYKVYRVSPVKANQLEGLRSLEANSEDALVLNNLHLGPTDF 65
            |..||||:|   |....||.:.|...||:||.|..|..:|.::|: |.:|.           .||
 Frog     1 MWALLLLVS---LAAVSAEPRNFHGEKVFRVIPQNAEHVELIKSM-AQTEG-----------LDF 50

  Fly    66 LVAPDFDGTFLKLVKDLDLSPELIDANAQTSLSLD---------------------IEPIADANR 109
            .: ||              |.:|::...:.....|                     |..:.||..
 Frog    51 WL-PD--------------SAQLVEQGKRADFHADGHVSYEVQALLQQSGMPYEILINDLQDALE 100

  Fly   110 RSDD------YSWSEYHELNDTHRWMQNLVGKYPDVVSVFVAGQSYEGRELLGLRINHNDGRAEK 168
            :..|      :|:.:|::|:..:.|..|:..:.|.:||....|.||:||.:..|::..:.  |.|
 Frog   101 KQRDSNIRAVHSYEKYNDLDTINAWSANIAAQNPGLVSRSSIGTSYQGRPIYLLKVGKSG--ANK 163

  Fly   169 QSIFLEAGMHAREWIGPATATYFANELLSSQ--QQEIMNLARSYVWYILPHANPDGYVYTHKTNR 231
            :::|::.|.||||||.||...:|..|.:|:.  :.|..:|..:...|:||..|.||||||..|||
 Frog   164 KAVFIDCGFHAREWISPAFCQWFVKEAVSAYGVESEFTSLLDNLDIYVLPVLNVDGYVYTWTTNR 228

  Fly   232 MWRKTRSPQ-DKNCVGTDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLKSVPEP 295
            |||||||.. :..|:|||||||::..|...|||:..|.|:|.|....||||.:.|:.|:::....
 Frog   229 MWRKTRSANPNSTCIGTDPNRNFNAGWCTAGASTRACDETYCGSAPESEPETKALANFIRANIPA 293

  Fly   296 MFMFLSLHSFSQLLLYPYGHTSALPENHRQLEQIFNTAVGAMKRRYGTRYTGGNVYDAIYPAAGS 360
            :..:|::||:||:||:||.::.|:.::|.:|..:...||.::...|.|:||.|.....||.|||.
 Frog   294 IKGYLTIHSYSQMLLFPYSYSYAVAKDHNELNAVAQGAVNSLTSLYKTKYTYGPGGSTIYLAAGG 358

  Fly   361 SMDWAYGVLNVKYSFTYELRPSG-YSFWTGFRLPAAQIIPTGQET 404
            |.||||.. .||:|:|:|||.:| |    ||.||.:||.||.:||
 Frog   359 SDDWAYDA-GVKFSYTFELRDTGRY----GFALPESQIKPTCEET 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416 14/66 (21%)
M14_CP_A-B_like 119..415 CDD:199844 120/290 (41%)
cpb1XP_031758320.1 Propep_M14 31..102 CDD:396700 15/97 (15%)
M14_CPB 111..410 CDD:349443 121/295 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 240 1.000 Domainoid score I2216
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I3126
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm9413
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.