Sequence 1: | NP_609309.1 | Gene: | CG4017 / 34296 | FlyBaseID: | FBgn0032143 | Length: | 424 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017210489.1 | Gene: | agbl5 / 445479 | ZFINID: | ZDB-GENE-040822-29 | Length: | 886 | Species: | Danio rerio |
Alignment Length: | 347 | Identity: | 72/347 - (20%) |
---|---|---|---|
Similarity: | 117/347 - (33%) | Gaps: | 105/347 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LLLLLSVNILIFCLAERQRFDNYKVYRVSPVKANQLEGLRSLEANSEDALVLNNLHLGP----TD 64
Fly 65 ----------FLVAPDFDGTFLKL-------------------VKDLDLS---------PELIDA 91
Fly 92 NAQTSLS-----LDIEPIADANRRSDDYSWSEYHE---------LNDT--------------HRW 128
Fly 129 M--QNLVGKYPDVVSVFVAGQSYEGRE---------LLGLRINHNDGRAEKQSIFLEAGMHAREW 182
Fly 183 IGPATATYFANELLSSQQQEIMNLARSYVWYILPHANPDGYVYTHKTNRMWRKTRSPQDKNCVGT 247
Fly 248 DPNRNW-----DFHWREVGASS 264 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4017 | NP_609309.1 | Propep_M14 | 30..97 | CDD:280416 | 19/108 (18%) |
M14_CP_A-B_like | 119..415 | CDD:199844 | 42/185 (23%) | ||
agbl5 | XP_017210489.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2866 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |