DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and agbl5

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_017210489.1 Gene:agbl5 / 445479 ZFINID:ZDB-GENE-040822-29 Length:886 Species:Danio rerio


Alignment Length:347 Identity:72/347 - (20%)
Similarity:117/347 - (33%) Gaps:105/347 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLLLSVNILIFCLAERQRFDNYKVYRVSPVKANQLEGLRSLEANSEDALVLNNLHLGP----TD 64
            :::.:.|...:|    ..|||:..:.||..|:|::..|..|..|:........|:...|    |:
Zfish     1 MVMEIRVGSAVF----SSRFDSGNLARVERVEASEAAGESSRSASVPQPDYEFNVWTRPDCASTE 61

  Fly    65 ----------FLVAPDFDGTFLKL-------------------VKDLDLS---------PELIDA 91
                      |.|.....|..||:                   |:.|.:.         |....:
Zfish    62 FENGNRSWFYFSVRGLLPGKLLKINMMNMNKQSKLYTQGMAPFVRTLPVKTRWERVRDRPTFEMS 126

  Fly    92 NAQTSLS-----LDIEPIADANRRSDDYSWSEYHE---------LNDT--------------HRW 128
            ::|..||     ||:..:.........:|::|..:         |:.|              ||.
Zfish   127 DSQFILSFVHRLLDVRGVTTYFSFCYPFSYAECQDMMLQLDHKFLSSTSTHTACSPPESIYYHRE 191

  Fly   129 M--QNLVGKYPDVVSVFVAGQSYEGRE---------LLGLRINHNDGRAEKQSIFLEAGMHAREW 182
            :  .:|.|...|:::|.......|.||         |...|.:...|   |:..|:.:.:|..|.
Zfish   192 LLCHSLDGHRVDLITVSSCHGLLEEREPRLDKLFPDLSTARSHRFTG---KRVFFVSSRVHPGET 253

  Fly   183 IGPATATYFANELLSSQQQEIMNLARSYVWYILPHANPDGYVYTHKTNRMWRKTRSPQDKNCVGT 247
            ........|.|.:||.:......|.|.:|:.::|..||||.|..|      .:|.|.      |.
Zfish   254 PSSFVFNGFLNFILSQEDPRAQTLRRMFVFKLIPMLNPDGVVRGH------YRTDSR------GV 306

  Fly   248 DPNRNW-----DFHWREVGASS 264
            :.||.:     |.|....||.|
Zfish   307 NLNRQYVNPSPDLHPSIYGAKS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416 19/108 (18%)
M14_CP_A-B_like 119..415 CDD:199844 42/185 (23%)
agbl5XP_017210489.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.