DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and Agbl5

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_038968402.1 Gene:Agbl5 / 362710 RGDID:1598311 Length:901 Species:Rattus norvegicus


Alignment Length:392 Identity:74/392 - (18%)
Similarity:124/392 - (31%) Gaps:160/392 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 YSWSEYHELNDTHRWMQNLVGKYPDVVSVFVA--GQSYEGRELL-----GLRI------------ 159
            :|:|:..:|      :..|..::|:..|...:  ...|..||||     |||:            
  Rat   159 FSYSDCQDL------LSQLDQRFPENYSAHSSPLDSIYYHRELLCYSLDGLRVDLLTITSCHGLR 217

  Fly   160 NHNDGRAE----------------KQSIFLEAGMHAREWIGPATATYFANELLSSQQQEIMNLAR 208
            :..:.|.|                |:..||.:.:|..|.........|.:.:|.........|.|
  Rat   218 DDREPRLEQLFPDVGTPRPFRFTGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTLRR 282

  Fly   209 SYVWYILPHANPDGYV------------------------------------YTHKTNRMWRKTR 237
            .:|:.::|..||||.|                                    |.|..:|:..|..
  Rat   283 LFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNSKNP 347

  Fly   238 SPQDKNCVGTDP-----------NRNWDFH------------WREVGASSDPCSESYAGPKAFSE 279
            |.|..:.:...|           |.:.:.|            |.|    ::|..|.       ::
  Rat   348 SNQQPSSLHLPPEVPLSDLEKANNLHNELHLGQSPDGENHDRWTE----TEPTEEK-------TD 401

  Fly   280 PEVQTLSQFLKSVPEP-----------MFMFLSLHSF-SQLLLYPYGHTSALPENHRQLEQI--- 329
            | |..:.|.:..:.||           :..::.||.. |:...:.||  ::..:...|:|.:   
  Rat   402 P-VWIMPQPIPELEEPAPDAIPPKESGVAYYVDLHGHASKRGCFMYG--NSFSDESTQVENMLYP 463

  Fly   330 ----FNTA-------------VGAMKRRYGTRYTG-GNVYDAIYPAAGSSMDWAYGVLNVKYSFT 376
                .|:|             :.|..||.|....| |.|  |||.|:|           :.:|:|
  Rat   464 KLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRV--AIYKASG-----------IIHSYT 515

  Fly   377 YE 378
            .|
  Rat   516 LE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 72/387 (19%)
Agbl5XP_038968402.1 Pepdidase_M14_N 10..155 CDD:407865
M14_AGBL5_like 183..575 CDD:349455 68/362 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.