DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and AGBL3

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_848658.3 Gene:AGBL3 / 340351 HGNCID:27981 Length:920 Species:Homo sapiens


Alignment Length:283 Identity:54/283 - (19%)
Similarity:90/283 - (31%) Gaps:91/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 INHNDGRAEKQSIFLEAGMHARE----WIGPATATYFANELLSSQQQEIMNLARSYVWYILPHAN 219
            :.::|.| :::::.|.|.:|..|    ||......|....  ||..|.:.:   ::|:.::|..|
Human   346 LKNSDSR-KRKAVILTARVHPGETNSSWIMKGFLDYILGN--SSDAQLLRD---TFVFKVVPMLN 404

  Fly   220 PDGYVYTHKTNRMWRKTRSPQDKNC--VGTDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEV 282
            |||.:.              .:..|  .|.|.|||:....:|                  |.|.|
Human   405 PDGVIV--------------GNYRCSLAGRDLNRNYTSLLKE------------------SFPSV 437

  Fly   283 QTLSQFLKSVPE--PMFMFLSLHSFS---------------------QLLLYPYGHTSALPENHR 324
            ......:..:.|  .:.::..||..|                     |..::|...:...|:...
Human   438 WYTRNMVHRLMEKREVILYCDLHGHSRKENIFMYGCDGSDRSKTLYLQQRIFPLMLSKNCPDKFS 502

  Fly   325 QLEQIFNTAVGAMKRRYGTRYTGGNVYDAIYPAAGSSMDWAYGVLNVKYSFTYELRPSGYSFWT- 388
            .....||    ..|.:.||               |..:.|..|:.|   |||.|....|.:... 
Human   503 FSACKFN----VQKSKEGT---------------GRVVMWKMGIRN---SFTMEATFCGSTLGNK 545

  Fly   389 -GFRLPAAQIIPTGQETTDSLVE 410
             |.......:...|....|||::
Human   546 RGTHFSTKDLESMGYHFCDSLLD 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 54/283 (19%)
AGBL3NP_848658.3 M14_AGBL2-3_like 310..570 CDD:133117 54/283 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..661
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.