DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and CG32379

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:334 Identity:111/334 - (33%)
Similarity:168/334 - (50%) Gaps:43/334 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DIEPIADANRRSD-----DYSWSE---------YHELNDTHRWMQNLVGKYPDVVSVFVAGQSYE 150
            |:.|:..|.|..:     ...|..         :.|:||   ::.:|:.::|..|.|...|.|||
  Fly    14 DLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEIND---YLDSLLERFPKRVQVKQFGWSYE 75

  Fly   151 GRELLGLRINHNDGRAEKQSIFLEAGMHAREWIGPATATYFANELLSS--QQQEIMNLARSYVWY 213
            .|.|..|.|.:.|||..|..|.::..:||||||.|:.|.|...:||.:  ..||::   :.|.|.
  Fly    76 RRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDNQELL---QDYDWV 137

  Fly   214 ILPHANPDGYVYTHKTNRMWRKTRSP-QDKNCVGTDPNRNWDFHW-REVGASSDPCSESYAGPKA 276
            |:|..|.|||.|||..:|.|||:|.| .:..|:|||.|||:.:.| .:.|:|||||...|.|.:.
  Fly   138 IMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSDPCENIYRGERP 202

  Fly   277 FSEPEVQTLSQFLKSVPEPMFMFLSLHSFSQLLLYPYGHTSALPENHRQLEQIFNTAVGAMKRRY 341
            |.:.|.|.|...:......:..:|||||:....|.|:|:||..|:.::.:..:.:  .||....|
  Fly   203 FDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMSVAD--AGAKAIIY 265

  Fly   342 GTR--YTGGNVYDAIYPAAGSSMDWAYGVLNVKYSFTYELRPSGY---------------SFWTG 389
            .|.  |:.|:.|..:||.:|.:.|:|:||:|...:.|.||..:|:               ..|.|
  Fly   266 STNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGFQGFDPWISQIERLVTESWVG 330

  Fly   390 FRLPAAQII 398
            .|..||::|
  Fly   331 VRAMAAEVI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 106/301 (35%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 105/301 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467014
Domainoid 1 1.000 158 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.