DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and Cpa6

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_038965675.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:290 Species:Rattus norvegicus


Alignment Length:288 Identity:111/288 - (38%)
Similarity:166/288 - (57%) Gaps:18/288 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 HELNDTHRWMQNLVGKYPDVVSVFVAGQSYEGRELLGLRINHNDGRAEKQSIFLEAGMHAREWIG 184
            |.||.|.          |.:|.||..|:|:|||.||.:::... .:..|::::::.|:|||||||
  Rat     2 HHLNQTQ----------PGLVRVFPIGRSFEGRSLLIIQLGRK-SQVYKRAVWIDCGIHAREWIG 55

  Fly   185 PATATYFANELLSSQQQE--IMNLARSYVWYILPHANPDGYVYTHKTNRMWRKTRSPQDK-NCVG 246
            ||...:|..|.:.:.:.:  :..:.....:||:|..|.|||.::...:|.||||||...| :|.|
  Rat    56 PAFCQWFVKEAILTYKTDPAMRKMLNHLYFYIMPVLNVDGYHFSWTHDRFWRKTRSRNSKFHCRG 120

  Fly   247 TDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLKSVPEPMFMFLSLHSFSQLLLY 311
            .|.||||...|.:.|||:|||.::|.||...|||||:.::.||:...:.:..:||.|:::|:|||
  Rat   121 VDANRNWKVKWCDEGASADPCDDTYCGPFPESEPEVKAVANFLRKHRKRIRAYLSFHAYAQMLLY 185

  Fly   312 PYGHTSALPENHRQLEQIFNTAVGAMKRRYGTRYTGGNVYDAIYPAAGSSMDWAYGVLNVKYSFT 376
            ||.:..|...|...:|...:.||.|::..:|.||..|.....:|.::|:|||||| ...:.|||.
  Rat   186 PYSYKHATIPNFSCVEFAAHKAVKALRSVHGIRYRHGPASQTLYVSSGNSMDWAY-KNGIPYSFA 249

  Fly   377 YELRPSGYSFWTGFRLPAAQIIPTGQET 404
            :|||.:||   .||.||...|.||..||
  Rat   250 FELRDTGY---FGFLLPEMLIKPTCTET 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 111/288 (39%)
Cpa6XP_038965675.1 Peptidase_M14_like 1..289 CDD:416253 111/288 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351704
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 262 1.000 Inparanoid score I3014
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.