DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001099570.1 Gene:Agtpbp1 / 290986 RGDID:1306307 Length:1219 Species:Rattus norvegicus


Alignment Length:238 Identity:52/238 - (21%)
Similarity:76/238 - (31%) Gaps:82/238 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 DDYSWSEYH-------------ELNDTHRWMQNLVGKYPDVVSVFVAGQS--------------Y 149
            ||..:..||             :|...|...|....|  ||:...::|.|              |
  Rat   832 DDVCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRK--DVLCETLSGNSCPLVTITAMPESSYY 894

  Fly   150 EGRELLGLRINHNDGRAEKQSIFLEAGMHARE----WIGPATATYFANELLSSQQQEIMNLARSY 210
            |          |......:..|||.|.:|..|    |:...|..|     |.|......:|..:|
  Rat   895 E----------HICQFRTRPYIFLSARVHPGETNASWVMKGTLEY-----LMSNSPTAQSLREAY 944

  Fly   211 VWYILPHANPDGYVYTHKTNRMWRKTRSPQDKNCVGTDPNRNWDFHWREVGASSDPCSESYAGPK 275
            ::.|:|..||||.:     |...|.:.|       |.|.||.|.                  .|.
  Rat   945 IFKIVPMLNPDGVI-----NGNHRCSLS-------GEDLNRQWQ------------------SPN 979

  Fly   276 AFSEPEV---QTLSQFLKSVPEPMFMFLSLHSFSQLL-LYPYG 314
            ....|.:   :.|.|:|.:|.....::...|..|:.. ::.||
  Rat   980 PELHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYG 1022

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 50/231 (22%)
Agtpbp1NP_001099570.1 Pepdidase_M14_N 705..839 CDD:407865 2/6 (33%)
M14_Nna1 862..1132 CDD:349477 46/208 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.