Sequence 1: | NP_609309.1 | Gene: | CG4017 / 34296 | FlyBaseID: | FBgn0032143 | Length: | 424 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848870.2 | Gene: | Agbl2 / 271813 | MGIID: | 2443254 | Length: | 862 | Species: | Mus musculus |
Alignment Length: | 243 | Identity: | 43/243 - (17%) |
---|---|---|---|
Similarity: | 80/243 - (32%) | Gaps: | 92/243 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 166 AEKQSIFLEAGMHAREWIGPATATYFAN---ELLSSQQQEIMNLARSYVWYILPHANPDGYVYTH 227
Fly 228 KTNRMWRKTRSPQDKNC--VGTDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLK 290
Fly 291 SVPEPMFMFLSLHSFSQLLLYPYGHTSALPENHRQLEQIFNTAVGAMKRRYGTRYTGGNVYDAIY 355
Fly 356 P-------------------------AAGSSMDWAYGVLNVKYSFTYE 378 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4017 | NP_609309.1 | Propep_M14 | 30..97 | CDD:280416 | |
M14_CP_A-B_like | 119..415 | CDD:199844 | 43/243 (18%) | ||
Agbl2 | NP_848870.2 | Pepdidase_M14_N | 231..358 | CDD:375499 | |
M14_AGBL2-3_like | 379..629 | CDD:349478 | 43/243 (18%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 669..692 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 704..728 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 750..836 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2866 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |