DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and Cpa3

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus


Alignment Length:411 Identity:136/411 - (33%)
Similarity:221/411 - (53%) Gaps:26/411 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLSVNILIFCLAERQRFDNYKVYRVSPVKANQLEGLRSLEANSE------DALVLNNLHLGPT- 63
            ||::|......:|. ..||..||:||..........|::|..:.|      ||  ::::.:..| 
Mouse     5 LLMAVIYTTLAIAP-VHFDREKVFRVKLQNEKHASVLKNLTQSIELDFWYPDA--IHDIAVNMTV 66

  Fly    64 DFLVAPDFDGTFLKLVKDLDLSPELI--DANAQTSLSLDIEPIADANRRSDDYSWSEYHELNDTH 126
            ||.|:.....|....::...:..|::  |...:.....|::     :..:..:|:::|::.:...
Mouse    67 DFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQFDVK-----DEIAGRHSYAKYNDWDKIV 126

  Fly   127 RWMQNLVGKYPDVVSVFVAGQSYEGRELLGLRINHNDGRAEKQSIFLEAGMHAREWIGPATATYF 191
            .|.:.::.|:|::||....|.:.|...|..|:|...||  |:::||::.|:||||||.||...:|
Mouse   127 SWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKDG--ERKAIFMDCGIHAREWISPAFCQWF 189

  Fly   192 ANELLSSQ-QQEIM-NLARSYVWYILPHANPDGYVYTHKTNRMWRKTRS-PQDKNCVGTDPNRNW 253
            ..:...|. :.:|| .|.....:|:||..|.|||:::...:|||||.|| .|:..|:|||.|||:
Mouse   190 VYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNF 254

  Fly   254 DFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLKSVPEPMFMFLSLHSFSQLLLYPYGHTSA 318
            |..|.....::.||...|.||...||.|.:.::.|::|....:..:::.||:||:||.|||:|..
Mouse   255 DVSWDSSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLIPYGYTFK 319

  Fly   319 LPENHRQLEQIFNTAVGAMKRRYGTRYTGGNVYDAIYPAAGSSMDWAYGVLNVKYSFTYELRPSG 383
            ||.||:.|.::...|..|:..||.|||..|.:...||..:|||:||.|. |.:|::|.:|||..|
Mouse   320 LPPNHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSGSSLDWVYD-LGIKHTFAFELRDKG 383

  Fly   384 YSFWTGFRLPAAQIIPTGQET 404
            .|   ||.||.::|.||.:||
Mouse   384 KS---GFLLPESRIKPTCKET 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416 14/75 (19%)
M14_CP_A-B_like 119..415 CDD:199844 112/289 (39%)
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 14/75 (19%)
Peptidase_M14_like 114..413 CDD:299699 113/294 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848055
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm8747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.