DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and AGBL1

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001373023.1 Gene:AGBL1 / 123624 HGNCID:26504 Length:1121 Species:Homo sapiens


Alignment Length:183 Identity:42/183 - (22%)
Similarity:63/183 - (34%) Gaps:59/183 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 LEAGMHARE----WIGPATATYFANELLSSQQQEIMNLARSYVWYILPHANPDGYVYTHKTNRMW 233
            :.|.:|..|    |:...|.     |.|.|.......|..::::.|:|..||||.:     |...
Human   799 ITARVHPGESNASWVMKGTL-----EFLVSSDPVARLLRENFIFKIIPMLNPDGVI-----NGNH 853

  Fly   234 RKTRSPQDKNCVGTDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEV---QTLSQFLKSVPEP 295
            |.:.|       |.|.||.|                  ..|.|..:|.:   :.|...|.|:...
Human   854 RCSLS-------GEDLNRQW------------------LSPSAHLQPTIYHAKGLLYHLSSIGRS 893

  Fly   296 MFMFLSLHSFSQ---LLLY-------------PYGHTSALPE-NHRQLEQIFN 331
            ..:|...|..||   :.||             ..|.::.|.| |:|.|.:|.:
Human   894 PVVFCDFHGHSQKKNVFLYGCSIKETLWQAACTVGTSTILEEVNYRTLPKILD 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416
M14_CP_A-B_like 119..415 CDD:199844 42/183 (23%)
AGBL1NP_001373023.1 Pepdidase_M14_N 596..730 CDD:407865
M14_Nna1 754..1019 CDD:349477 42/183 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.