DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and LOC100490370

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_031749426.1 Gene:LOC100490370 / 100490370 -ID:- Length:491 Species:Xenopus tropicalis


Alignment Length:415 Identity:123/415 - (29%)
Similarity:217/415 - (52%) Gaps:45/415 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FDNYKVYRVSPVKANQLEGLRSL----------EANSEDALVLNNLHLGPTDFLVAPDFDGTFLK 77
            :|...:..::|....|::.|:::          ....||..|...:|:         ....|.|:
 Frog    62 YDGGNILEITPESEKQVQCLQNILQSWLLDLLKPLQPEDINVKTTVHV---------RIPSTALQ 117

  Fly    78 LVKDLDL-----SPELIDANAQTSLSLDIEPIADANRRSDDYSWSEYHELNDTHRWMQNLVGKYP 137
            |||: ||     |.|::..|.: .:..|.....:..:..::|:::.||.:|:.:.|:..:..|:.
 Frog   118 LVKE-DLLHCSQSLEILTGNVK-YIEEDKIDTKETRKTINEYNYTTYHPMNEIYDWINGIAKKHS 180

  Fly   138 DVVSVFVAGQSYEGRELLGLRI-----NHNDGRAEKQSIFLEAGMHAREWIGPATATYFANE-LL 196
            ..|:..:.|.:||.|.:..|:|     ||      |:.::::.|:||||||.||...:|..| ::
 Frog   181 QFVTQHLLGLTYESRPMQYLKISQPSENH------KKIVWIDCGIHAREWIAPAFCQWFVKEQIV 239

  Fly   197 SSQQ--QEIMNLARSYVWYILPHANPDGYVYTHKTNRMWRKTRSPQ-DKNCVGTDPNRNWDFHWR 258
            .:.|  |.|..:.::...|:||..|.|||:|:....|:|||.||.. :..|.|.|.|||::..|.
 Frog   240 QNYQNDQRIRKILQNLDIYVLPVLNIDGYIYSWTKERLWRKNRSQYGNGTCYGVDLNRNFNVSWC 304

  Fly   259 EVGASSDPCSESYAGPKAFSEPEVQTLSQFLKSVPEPMFMFLSLHSFSQLLLYPYGHTSALPENH 323
            ...:|::..|.|:.|....||||.:.:.:|::|....:..||::||:|||:|..||:::.|..|:
 Frog   305 THRSSTNCSSNSFCGSSPVSEPETRAVVEFVESRKADIVCFLTMHSYSQLILTAYGYSTGLSRNY 369

  Fly   324 RQLEQIFNTAVGAMKRRYGTRYTGGNVYDAIYPAAGSSMDWAYGVLNVKYSFTYELRPSGYSFWT 388
            .::.::...|..||::.:||:|..|.....:|.|:|:|.||.:. |.:.:|||:|||.:|..   
 Frog   370 NEIFKVAEMAASAMEKIHGTKYRAGPFSKLLYEASGTSQDWVHD-LGIDFSFTFELRDNGSH--- 430

  Fly   389 GFRLPAAQIIPTGQETTDSLVEMIK 413
            .|.||..||.||.:||...::.:|:
 Frog   431 KFTLPEDQIQPTCEETMAGVMTIIE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416 17/81 (21%)
M14_CP_A-B_like 119..415 CDD:199844 103/304 (34%)
LOC100490370XP_031749426.1 Propep_M14 73..>123 CDD:396700 11/59 (19%)
Peptidase_M14_like 159..457 CDD:416253 103/307 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.