DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4017 and cpb2

DIOPT Version :9

Sequence 1:NP_609309.1 Gene:CG4017 / 34296 FlyBaseID:FBgn0032143 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001018539.2 Gene:cpb2 / 100000935 ZFINID:ZDB-GENE-050522-259 Length:424 Species:Danio rerio


Alignment Length:434 Identity:142/434 - (32%)
Similarity:222/434 - (51%) Gaps:54/434 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLLLLSVNILIF---CLAERQRFDNYKVYRVSPVKANQLEGLRSLEANSEDAL--------VLN 56
            |:.|...:...||   ||.   :..:.:|..::......:|.:::|.:::|.||        :..
Zfish     4 LIQLAYFICFSIFLETCLC---KVKHDQVLAITVSSQEHVEKVQNLTSHNETALWQPASPNYITT 65

  Fly    57 N--LHLGPTDFLVAPDFDGTFLKLVK----DLDLSPELIDANAQTSLSLDIEPIADANRRSDDYS 115
            |  :||         ....|.::.||    :..::..::..|....:::.|.     |..||..|
Zfish    66 NSEVHL---------YIQSTSVQFVKEHLREHAITFRVLVENTAALVAMQIR-----NDTSDPRS 116

  Fly   116 ----WSEYHELNDTHRWMQNLVGKYPDVVSVFVAGQSYEGRELLGLRINHNDGRAEKQ---SIFL 173
                :..||.|.|.:.|:.....::.|:|.|.:.|.|.|.|.|..|:::   |:.|::   ::::
Zfish   117 GGVFYERYHSLEDIYYWINKTSREHSDMVKVILIGSSSEKRPLYVLKLS---GKREEEVNRAMWM 178

  Fly   174 EAGMHAREWIGPATATYFANELLS--SQQQEIMNLARSYVWYILPHANPDGYVYTHKTNRMWRKT 236
            :.|:||||||.||...:|.|..|:  :|..||..:......|||...|||||.||..|:|||||.
Zfish   179 DCGIHAREWIAPAFCMWFVNYALAFYNQNTEITEMLNKMDIYILTVMNPDGYKYTWTTDRMWRKN 243

  Fly   237 RSP-QDKNCVGTDPNRNWDFHWREVGASSDPCSESYAGPKAFSEPEVQTLSQFLKSVPEPMFMFL 300
            ||. :|..|.|.|.|||:|.:|...|||.|||..:|.|....||||.|.:::||:|..:.:.::|
Zfish   244 RSENKDSYCAGVDLNRNFDANWCTKGASDDPCDPTYCGQFPESEPETQAVAKFLRSHKDTVKLYL 308

  Fly   301 SLHSFSQLLLYPYGHTSALPENHRQLEQIFNTAVGAMKRRYGTRYTGGNVYDAIYPAAGSSMDWA 365
            |:||:||:||:||..:.....||.:|.::...|...::|.|...|..|:....||.|.|.|.|||
Zfish   309 SIHSYSQMLLFPYSCSYNEIPNHNELFELVKEASTKIRRYYRNNYKYGSGAKTIYLAPGGSDDWA 373

  Fly   366 YGVLNVKYSFTYELRPSGYSFWTGFRLPAAQIIPTGQETTDSLV 409
            |. |.:|||||:||:..|.   .||.||.: .||  |...::|:
Zfish   374 YD-LGIKYSFTFELQDRGQ---YGFLLPPS-FIP--QACNEALL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4017NP_609309.1 Propep_M14 30..97 CDD:280416 12/80 (15%)
M14_CP_A-B_like 119..415 CDD:199844 118/297 (40%)
cpb2NP_001018539.2 Propep_M14 32..98 CDD:280416 11/74 (15%)
M14_CPB2 120..420 CDD:199868 118/301 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - mtm6559
orthoMCL 1 0.900 - - OOG6_100142
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1730
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.680

Return to query results.
Submit another query.