DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment und and metap1d

DIOPT Version :9

Sequence 1:NP_001260299.1 Gene:und / 34294 FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001019563.1 Gene:metap1d / 554090 ZFINID:ZDB-GENE-050522-71 Length:338 Species:Danio rerio


Alignment Length:283 Identity:67/283 - (23%)
Similarity:100/283 - (35%) Gaps:62/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PTIPIAKLYPDGNFPEGEIVEHPTPKDMPDDRTAKDRFTSEEKRALDRINTDIYQELRQAAEAHR 147
            |..|:.|     :....:.|......:.||....||    ||:          .|.||:|.:..|
Zfish    63 PAYPVPK-----HIQRPDYVSSSKVPEWPDYIEIKD----EEQ----------IQGLRRACQLAR 108

  Fly   148 QTRQYMQRYIKPGMTMIQICEELENTARRLIGENGLEAGL---AFPTG-C-SLNHCAAHYTPNAG 207
            .........:|.|||..:|...:...|   |..||..:.|   .||.. | |:|:...|..|   
Zfish   109 HILLLTGNSLKVGMTTDEIDFIVHQEA---IRHNGYPSPLHYGGFPKSVCTSVNNVVCHGIP--- 167

  Fly   208 DPTVLQYDDVCKIDFGTHIKGRIIDCAFTL---TFNNKYDKLLQAVKEATNTGIREAGIDVRLCD 269
            |...||..|:..||...:::|...|.:.|.   :.|::..||:...::..:..|...|....||.
Zfish   168 DSRPLQDGDIINIDVTVYLEGYHGDTSETFLIGSVNDQGRKLVDVARQCRDQAIAACGPGQPLCV 232

  Fly   270 IGAAIQEVMESYEIELDGKTYPIKAIRNLNGHSISPYRI--------HAGKTVPIVKGGESTRME 326
            ||..|..                  |.|.||..:.||.|        |....:.........:||
Zfish   233 IGNIISN------------------IANSNGFRVCPYFIGHGIGEYFHGHPEIWHHANDNDLKME 279

  Fly   327 EDEFYAIETF---GSTGRGLVHD 346
            |...:.||..   |::|..::.|
Zfish   280 EGMSFTIEPILMEGTSGFRILSD 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 67/283 (24%)
metap1dNP_001019563.1 PRK12318 63..334 CDD:183434 67/283 (24%)
MetAP1 97..333 CDD:238519 57/230 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.