DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment und and CG10576

DIOPT Version :9

Sequence 1:NP_001260299.1 Gene:und / 34294 FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster


Alignment Length:373 Identity:93/373 - (24%)
Similarity:157/373 - (42%) Gaps:87/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PDDRTAKDRFTSEEKRALDRINTDIYQELRQAAEAHRQTRQYMQRYIKPGMTMI-----QICEEL 170
            |:...|:|...::.|.|.:.:|..:...:                    |:.::     :||.:.
  Fly     8 PEKTIAEDLVVTKYKLAGEIVNKTLKAVI--------------------GLCVVDASVREICTQG 52

  Fly   171 ENTARRLIG-----ENGLEAGLAFPTGCSLNHCAAHYTP--NAGDPTVLQYDDVCKIDFGTHIKG 228
            :|......|     |..|:.|:||||..|:|:|..|::|  |..|.| |:..||.|||.|.||.|
  Fly    53 DNQLTEETGKVYKKEKDLKKGIAFPTCLSVNNCVCHFSPAKNDADYT-LKAGDVVKIDLGAHIDG 116

  Fly   229 RIIDCAFTLTFNNKYDKLLQAVKEATNTGIREAGI----------DVRLCDIGA-------AIQE 276
            .|...|.|:......|:.:..         |:|.:          .:||...||       |:|:
  Fly   117 FIAVAAHTIVVGAAADQKISG---------RQADVILAAYWAVQAALRLLKSGANNYSLTDAVQQ 172

  Fly   277 VMESYEIELDGKTYPIKAIRNLNGHSISPYRIHAGKTVPIVKGGESTRMEED-------EFYAIE 334
            :.|||:         .|.|..:..|.:..::|...||: |....|:.|.|.:       |.|||:
  Fly   173 ISESYK---------CKPIEGMLSHELKQFKIDGEKTI-IQNPSEAQRKEHEKCTFETYEVYAID 227

  Fly   335 TFGSTGRGLVHD-DMDCSHYMK---NFDLPFVPLRLQSSKQLLGTINKNFGTLAFCKRWLDRAGA 395
            ...|||.|:..: |...|.|.|   |:     .|::::|:.||..:...:|.:.|..|..:.  .
  Fly   228 VIVSTGEGVGREKDTKVSIYKKSEENY-----MLKMKASRALLAEVKTKYGNMPFNIRSFEE--E 285

  Fly   396 TKYQMALKDLCDKGIVEAYPPLCDIKGCYTAQYEHTIMLRPTCKEVVS 443
            ||.:|.:.:.....::|.:..|.:......||::||::|.|....:|:
  Fly   286 TKARMGVVECVGHKMIEPFQVLYEKPSEIVAQFKHTVLLMPNGVNLVT 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 93/373 (25%)
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 93/373 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456476
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.