DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment und and pa2g4b

DIOPT Version :9

Sequence 1:NP_001260299.1 Gene:und / 34294 FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_997806.1 Gene:pa2g4b / 323462 ZFINID:ZDB-GENE-030131-2182 Length:394 Species:Danio rerio


Alignment Length:349 Identity:83/349 - (23%)
Similarity:151/349 - (43%) Gaps:52/349 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DMPDDRTAKDRFTSEEKRALDRINTDIYQELRQAAEAHRQTRQYMQRYIKPGMTMIQICEE---- 169
            |..:...|.|...::.|...|..|.    .|:...||           .|||::::.:||:    
Zfish     6 DQQEQTIADDLVVTKYKMGADIANL----ALKTVIEA-----------AKPGVSVLSLCEKGDAF 55

  Fly   170 -LENTARRLIGENGLEAGLAFPTGCSLNHCAAHYTPNAGDPTVLQYD-DVCKIDFGTHIKGRIID 232
             ...|::....|..::.|:||||..|:|:|..|::|...||..:..| |:.|||.|.|:.|.|.:
Zfish    56 IAAETSKVFKKEKEIKKGIAFPTCVSVNNCVCHFSPIKSDPDYMLKDGDLVKIDLGVHVDGFISN 120

  Fly   233 CAFTLTFNNKYDKLLQAVKEATNTGIREAGI----------DVRLCDIGAAIQEVMESY-EIELD 286
            .|.:.        ::.|.|:|..|| |:|.:          .:||...|....:|.|:: :|...
Zfish   121 VAHSF--------VVGATKDAPVTG-RKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAQS 176

  Fly   287 GKTYPIKAIRNLNGHSISPYRIHAGKTV---PI---VKGGESTRMEEDEFYAIETFGSTGRGLVH 345
            .|..||:.:.:   |.:..:.|...||:   |.   .|..|....|..|.||::...|||.|...
Zfish   177 FKCMPIEGMLS---HQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLVSTGEGKAR 238

  Fly   346 DDMDCSHYMKNFDLPFVPLRLQSSKQLLGTINKNFGTLAFCKRWLDRAGATKYQMALKDLCDKGI 410
            |....:...|........|::::|:.....:.:.|..:.|..|..:  ..:|.::.:.:.....:
Zfish   239 DSGQRTTVYKRDPSKQYGLKMKTSRMFFSEVERRFDAMPFTLRAFE--DESKARLGVVECAKHEL 301

  Fly   411 VEAYPPLCDIKGCYTAQYEHTIML 434
            ::.:..|.:.:|.:.||::.|::|
Zfish   302 LQPFSVLHEKEGEHVAQFKFTVLL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 83/349 (24%)
pa2g4bNP_997806.1 crvDNA_42K 1..387 CDD:273105 83/349 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586499
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.