DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment und and T27A8.3

DIOPT Version :9

Sequence 1:NP_001260299.1 Gene:und / 34294 FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_510627.1 Gene:T27A8.3 / 188968 WormBaseID:WBGene00012075 Length:182 Species:Caenorhabditis elegans


Alignment Length:123 Identity:80/123 - (65%)
Similarity:92/123 - (74%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 ELDGKTYPIKAIRNLNGHSISPYRIHAGKTVPIVKGGESTRMEEDEFYAIETFGSTGRGLVHDDM 348
            |..|.:..:|.|.:|||.||:..|||.|||||||||||..||||:|.||||||||||:|..||||
 Worm    29 EFHGNSNEVKPIGSLNGQSIAQCRIHTGKTVPIVKGGEQARMEENEIYAIETFGSTGKGYFHDDM 93

  Fly   349 DCSHYMKNFDL--PFVPLRLQSSKQLLGTINKNFGTLAFCKRWLDRAGATKYQMALKD 404
            :.|||||||:|  ..:|||||.||.||..|:|||.|||||:.|:||...|||.|||||
 Worm    94 ETSHYMKNFELADEKIPLRLQKSKGLLKLIDKNFATLAFCRCWIDRLEETKYLMALKD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 80/123 (65%)
T27A8.3NP_510627.1 APP_MetAP <37..151 CDD:294199 76/113 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S177
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45777
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.