DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment und and Pa2g4

DIOPT Version :9

Sequence 1:NP_001260299.1 Gene:und / 34294 FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_035249.1 Gene:Pa2g4 / 18813 MGIID:894684 Length:394 Species:Mus musculus


Alignment Length:352 Identity:79/352 - (22%)
Similarity:146/352 - (41%) Gaps:51/352 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 KDMPDDRT-AKDRFTSEEKRALDRINTDIYQELRQAAEAHRQTRQYMQRYIKPGMTMIQICEE-- 169
            :|...::| |:|...::.|...|..|    :.||...||.           ..|::::.:||:  
Mouse     4 EDEQQEQTIAEDLVVTKYKMGGDIAN----RVLRSLVEAS-----------SSGVSVLSLCEKGD 53

  Fly   170 ---LENTARRLIGENGLEAGLAFPTGCSLNHCAAHYTPNAGDPT-VLQYDDVCKIDFGTHIKGRI 230
               :|.|.:....|..::.|:||||..|:|:|..|::|...|.. :|:..|:.|||.|.|:.|.|
Mouse    54 AMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI 118

  Fly   231 IDCAFTLTFNNKYDKLLQAVKEATNTGIREAGI----------DVRLCDIGAAIQEVMESYEIEL 285
            .:.|.|...         .|.:.|....|:|.:          .:||...|....:|.|::  ..
Mouse   119 ANVAHTFVI---------GVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAW--NK 172

  Fly   286 DGKTYPIKAIRNLNGHSISPYRIHAGKTV---PI---VKGGESTRMEEDEFYAIETFGSTGRGLV 344
            ...::....|..:..|.:..:.|...||:   |.   .|..|....|..|.||::...|:|.|..
Mouse   173 VAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKA 237

  Fly   345 HDDMDCSHYMKNFDLPFVPLRLQSSKQLLGTINKNFGTLAFCKRWLDRAGATKYQMALKDLCDKG 409
            .|....:...|........|::::|:.....:.:.|..:.|..|..:  ...|.:|.:.:.....
Mouse   238 KDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFE--DEKKARMGVVECAKHE 300

  Fly   410 IVEAYPPLCDIKGCYTAQYEHTIMLRP 436
            :::.:..|.:.:|.:.||::.|::|.|
Mouse   301 LLQPFNVLYEKEGEFVAQFKFTVLLMP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 79/352 (22%)
Pa2g4NP_035249.1 crvDNA_42K 1..388 CDD:273105 79/352 (22%)
Necessary for nucleolar localization. /evidence=ECO:0000250|UniProtKB:Q9UQ80 2..48 12/58 (21%)
RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9UQ80 46..54 2/7 (29%)
Necessary for nucleolar localization. /evidence=ECO:0000250|UniProtKB:Q9UQ80 301..394 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..394
Interaction with RNA. /evidence=ECO:0000269|PubMed:17690690 361..375
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842037
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.