DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf11 and TAF11b

DIOPT Version :9

Sequence 1:NP_723484.1 Gene:Taf11 / 34293 FlyBaseID:FBgn0011291 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_173429.1 Gene:TAF11b / 838589 AraportID:AT1G20000 Length:204 Species:Arabidopsis thaliana


Alignment Length:178 Identity:62/178 - (34%)
Similarity:98/178 - (55%) Gaps:29/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TSDPGNDADRDGKDADGDNDNKNTDGDGDSGEPAHKKLKTKKELEEEERE--------------- 87
            :.||...|..:.:::..:.: :..:||    |.|.||.||....|.:.::               
plant    35 SKDPFEAAMEEQEESPVETE-QTLEGD----ERAVKKCKTSVVAEAKNKDEVEFTKNITGADPVT 94

  Fly    88 ---RMQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQTITG---CSVSQNVVIAMSGIAKVFVG 146
               :||.::|.|||||:.|||.:|||.|.|:.:::|:|.|||   ...:.|:|:  .||||:|||
plant    95 RANKMQKILSQFTEEQMSRYESFRRSGFKKSDMEKLVQRITGGPKMDDTMNIVV--RGIAKMFVG 157

  Fly   147 EVVEEALDVMEAQGESGALQPKFIREAVRRLRTKDRMPIGRYQQPYFR 194
            ::||.|..||..:.|||.::|..|||:.|||:.:.::| .|..|..||
plant   158 DLVETARVVMRERKESGPIRPCHIRESYRRLKLQGKVP-QRSVQRLFR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf11NP_723484.1 TAFII28 91..175 CDD:282562 40/86 (47%)
TAF11bNP_173429.1 TAFII28 102..186 CDD:398410 40/85 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I3061
eggNOG 1 0.900 - - E1_COG5251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2270
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000999
OrthoInspector 1 1.000 - - otm2720
orthoMCL 1 0.900 - - OOG6_103964
Panther 1 1.100 - - O PTHR13218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.