DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf11 and TAF11

DIOPT Version :9

Sequence 1:NP_723484.1 Gene:Taf11 / 34293 FlyBaseID:FBgn0011291 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_193761.1 Gene:TAF11 / 827775 AraportID:AT4G20280 Length:210 Species:Arabidopsis thaliana


Alignment Length:198 Identity:66/198 - (33%)
Similarity:98/198 - (49%) Gaps:43/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FQSA-SGERKDSDTSDP-----GNDADRDGK---DADGDNDNKNTDGDGDSGEPAHK-------- 73
            |::| ..|:::|....|     |.|...||:   |...|.|.:..    |...|..|        
plant     8 FEAAIEEEQEESPPESPVGGGGGGDGSEDGRIEIDQTQDEDERPV----DVRRPMKKAKTSVVVT 68

  Fly    74 --KLKTKKELEEEERE-------------------RMQVLVSNFTEEQLDRYEMYRRSAFPKAAV 117
              |.|.|.|.:|||.|                   :||.::|.|||:|:.|||.:||||..:..:
plant    69 EAKNKDKDEDDEEEEENMDVELTKYPTSSDPAKMAKMQTILSQFTEDQMSRYESFRRSALQRPQM 133

  Fly   118 KRLMQTITGC-SVSQNVVIAMSGIAKVFVGEVVEEALDVMEAQGESGALQPKFIREAVRRLRTKD 181
            |:|:..:||. .:...::|...||||:||||:||.|..||..:.|||.::|..|||:.|||:.:.
plant   134 KKLLIGVTGSQKIGMPMIIVACGIAKMFVGELVETARVVMAERKESGPIRPCHIRESYRRLKLEG 198

  Fly   182 RMP 184
            ::|
plant   199 KVP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf11NP_723484.1 TAFII28 91..175 CDD:282562 37/84 (44%)
TAF11NP_193761.1 TAFII28 108..192 CDD:368078 37/83 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I3061
eggNOG 1 0.900 - - E1_COG5251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2270
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000999
OrthoInspector 1 1.000 - - otm2720
orthoMCL 1 0.900 - - OOG6_103964
Panther 1 1.100 - - LDO PTHR13218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.