DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf11 and TAF11

DIOPT Version :9

Sequence 1:NP_723484.1 Gene:Taf11 / 34293 FlyBaseID:FBgn0011291 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_005634.1 Gene:TAF11 / 6882 HGNCID:11544 Length:211 Species:Homo sapiens


Alignment Length:187 Identity:99/187 - (52%)
Similarity:128/187 - (68%) Gaps:25/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SDGD-DVDLKFFQSASGERKDSDTSDPGNDADRDGKDADGDNDNKNTDGDGDSGEPAHKKLK--- 76
            :||| |||||...:..||.:..|.||. ...:|:               |.....||.||||   
Human    40 TDGDADVDLKEAAAEEGELESQDVSDL-TTVERE---------------DSSLLNPAAKKLKIDT 88

  Fly    77 -----TKKELEEEERERMQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQTITGCSVSQNVVIA 136
                 .|::::|:|.::||:|||:|:||||:||||||||||||||:|||:|:|||.|||||||||
Human    89 KEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIA 153

  Fly   137 MSGIAKVFVGEVVEEALDVMEAQGESGALQPKFIREAVRRLRTKDRMPIGRYQQPYF 193
            ||||:||||||||||||||.|..||...||||.:|||||||::|.::|..::::..|
Human   154 MSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf11NP_723484.1 TAFII28 91..175 CDD:282562 66/83 (80%)
TAF11NP_005634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81 16/56 (29%)
TAFII28 108..192 CDD:398410 66/83 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158782
Domainoid 1 1.000 134 1.000 Domainoid score I5021
eggNOG 1 0.900 - - E1_COG5251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55918
Inparanoid 1 1.050 167 1.000 Inparanoid score I4162
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000999
OrthoInspector 1 1.000 - - otm40746
orthoMCL 1 0.900 - - OOG6_103964
Panther 1 1.100 - - LDO PTHR13218
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1469
SonicParanoid 1 1.000 - - X930
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.