DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf11 and taf-11.3

DIOPT Version :9

Sequence 1:NP_723484.1 Gene:Taf11 / 34293 FlyBaseID:FBgn0011291 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_499315.3 Gene:taf-11.3 / 260198 WormBaseID:WBGene00006395 Length:228 Species:Caenorhabditis elegans


Alignment Length:227 Identity:56/227 - (24%)
Similarity:96/227 - (42%) Gaps:64/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSDGDDVD-------LKFFQSASGERKDSDTSDPGNDADRDGKDADGDNDNKNTDGDGDSG---- 68
            |||.|..|       ||..:.:|.|.:.::.|          ||...:...|.::....|.    
 Worm    13 LSDSDSDDEIVPTSVLKDLEMSSEEDEIAELS----------KDTPPEKKRKISESGASSSSFIP 67

  Fly    69 EPAHKK---LKTKK----------------------------------ELEEEERERMQVLVSNF 96
            |...::   ||:||                                  :.:||:.....:|::||
 Worm    68 ESTSEESLSLKSKKSGSRKRILTASSSTNSIAMKSSASWIQEKDTPINKSDEEKSIAESLLIANF 132

  Fly    97 TEEQLDRYEMYRRSAFPKAAVKRLMQTITGCSVSQNVVIAMSGIAKVFVGEVVEEALDVMEAQGE 161
            :.||||||..::||.|.:..:|.::...||...|..:.:|::|:.|:|:|::||||:::..|..|
 Worm   133 SNEQLDRYTAFKRSRFNRRIIKNVITRTTGQIPSDPLALAVAGLTKMFIGDLVEEAVELRGALNE 197

  Fly   162 SG-ALQPKFIREAVRRLRTKDRMPIGRYQQPY 192
            .. .:||..|..|..:|..:     |:...||
 Worm   198 QDRPVQPYHITRAFDKLLAE-----GKLWPPY 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf11NP_723484.1 TAFII28 91..175 CDD:282562 31/84 (37%)
taf-11.3NP_499315.3 TAFII28 127..211 CDD:368078 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5251
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000999
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.