DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf11 and taf-11.2

DIOPT Version :9

Sequence 1:NP_723484.1 Gene:Taf11 / 34293 FlyBaseID:FBgn0011291 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_492019.2 Gene:taf-11.2 / 172451 WormBaseID:WBGene00006394 Length:281 Species:Caenorhabditis elegans


Alignment Length:188 Identity:63/188 - (33%)
Similarity:95/188 - (50%) Gaps:60/188 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NDNKNT------------------DGDGDS------------GEPAHKKLKTKKE---------- 80
            |||.:|                  ||.|.|            .|...|:|:.:||          
 Worm    85 NDNTSTIVFKSFWMHNGKPIREIVDGQGTSQFTACFKESVREEEQRRKRLREEKEKENAMRAASP 149

  Fly    81 -------------LEEEERE----RMQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQTIT-GC 127
                         ||:||:|    :.||||:||::||::|||:||:|:|.|:.:|||:...| |.
 Worm   150 EIPAGPPPTKRQILEQEEKEIILLKNQVLVANFSQEQIERYEVYRKSSFKKSTIKRLINEFTGGI 214

  Fly   128 SVSQNVVIAMSGIAKVFVGEVVEEALDV--MEAQGESGALQPKFIREAVRRLRTKDRM 183
            .:.:.|.||::|:|||.|||:||||||:  ::.:.....|||..||:|..||..:.::
 Worm   215 DLGKKVDIAVAGLAKVLVGEIVEEALDIRDLDEKEAKEPLQPHHIRQAYLRLGEQGKL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf11NP_723484.1 TAFII28 91..175 CDD:282562 42/86 (49%)
taf-11.2NP_492019.2 TAF11 182..267 CDD:173967 39/84 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166300
Domainoid 1 1.000 94 1.000 Domainoid score I4702
eggNOG 1 0.900 - - E1_COG5251
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000999
OrthoInspector 1 1.000 - - otm14098
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X930
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.