DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf11 and taf11

DIOPT Version :9

Sequence 1:NP_723484.1 Gene:Taf11 / 34293 FlyBaseID:FBgn0011291 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_012812116.1 Gene:taf11 / 100151705 XenbaseID:XB-GENE-491199 Length:254 Species:Xenopus tropicalis


Alignment Length:194 Identity:94/194 - (48%)
Similarity:133/194 - (68%) Gaps:24/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DEILFPTQQKSNSLSDGDDVDLKFFQSA--SGERKDSDTSDPGNDADRDGKDADGDNDNKNTDGD 64
            |.:|  .||..:...||:| ::|..:|.  ||..:..:|||..: |.|..|              
 Frog    83 DRVL--VQQVKSEQEDGED-EVKVAESPEHSGVTEPIETSDLAS-ASRKVK-------------- 129

  Fly    65 GDSGEPAHKKLKTKKELEEEERERMQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQTITGCSV 129
                ..|.::.:.|::::|:|.::||:|||:|:||||:||||||||||||||:|||:|.||||||
 Frog   130 ----LEAKERREKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQNITGCSV 190

  Fly   130 SQNVVIAMSGIAKVFVGEVVEEALDVMEAQGESGALQPKFIREAVRRLRTKDRMPIGRYQQPYF 193
            |||||||||||:||||||||||||||.|..|::..|||:.:|||:|||:::.::|..:|::..|
 Frog   191 SQNVVIAMSGISKVFVGEVVEEALDVCEKWGDNPPLQPRHMREALRRLKSRGQIPNSKYKKIMF 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf11NP_723484.1 TAFII28 91..175 CDD:282562 65/83 (78%)
taf11XP_012812116.1 TAFII28 152..236 CDD:368078 65/83 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I4944
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55918
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000999
OrthoInspector 1 1.000 - - oto102933
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1469
SonicParanoid 1 1.000 - - X930
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.