DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment zf30C and Klf5

DIOPT Version :9

Sequence 1:	NP_477301.1	Gene:	zf30C / 34292	FlyBaseID:	FBgn0270924	Length:	777	Species:	Drosophila melanogaster
Sequence 2:	NP_445846.3	Gene:	Klf5 / 84410	RGDID:	621446	Length:	443	Species:	Rattus norvegicus

Alignment Length:	79	Identity:	29/79 - (36%)
Similarity:	38/79 - (48%)	Gaps:	3/79 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   604 DKCGKTFKVKAQYKSHLKTRHTDYKPYKC--HLCPKEYPYRESLLTHMTVHTGIKRFLCNNCGKR 666
            |.|.|.:...:..|:||:| ||..|||||  ..|...:...:.|..|...|||.|.|.|..|.:.
  Rat   364 DGCTKVYTKSSHLKAHLRT-HTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCVVCNRS 427

  Fly   667 FTCISNLQAHRKVH 680
            |:...:|..|.|.|
  Rat   428 FSRSDHLALHMKRH 441

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
zf30C	NP_477301.1	C2H2 Zn finger	33..53	CDD:275368
		C2H2 Zn finger	61..82	CDD:275368
		C2H2 Zn finger	98..117	CDD:275368
		C2H2 Zn finger	134..152	CDD:275368
		C2H2 Zn finger	511..532	CDD:275370
		COG5048	<523..>672	CDD:227381	25/69 (36%)
		C2H2 Zn finger	546..566	CDD:275368
		C2H2 Zn finger	575..595	CDD:275368
		C2H2 Zn finger	603..624	CDD:275368	7/19 (37%)
		C2H2 Zn finger	632..652	CDD:275368	4/21 (19%)
		C2H2 Zn finger	660..680	CDD:275368	6/19 (32%)
Klf5	NP_445846.3	KLF5_N	3..356	CDD:410335
		COG5048	345..>419	CDD:227381	21/55 (38%)
		C2H2 Zn finger	361..383	CDD:275368	7/19 (37%)
		C2H2 Zn finger	391..413	CDD:275368	4/21 (19%)
		zf-H2C2_2	405..430	CDD:404364	10/24 (42%)
		zf-C2H2	419..441	CDD:395048	7/21 (33%)
		C2H2 Zn finger	421..441	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E33208_3BRQ6
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900