DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and klf5l

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001035016.2 Gene:klf5l / 562670 ZFINID:ZDB-GENE-060312-34 Length:401 Species:Danio rerio


Alignment Length:473 Identity:99/473 - (20%)
Similarity:153/473 - (32%) Gaps:151/473 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 TESTDIFSNEKDKLLDVLLNEGDGLKP---FESLKVEQGAGILDEIAAVPLVEVAEEDVLELRGH 334
            ||...:|:    :|..|.:..|||.:.   ||.:|              |.|.:|...| |:...
Zfish    13 TEERAVFT----QLKPVRMCSGDGPEDSSVFEDVK--------------PAVRIATNPV-EMAQT 58

  Fly   335 QMEKPPGPRKRGRPPKEKIPVVKRKYRKRNAP-RSPSPDDSSGTPKRVAKISKKELKERLKMINK 398
            :||..                   ||..::.| .||:..|            ||..:|...::::
Zfish    59 RMEMD-------------------KYLPQSGPLLSPNITD------------KKYRRESASVVDE 92

  Fly   399 MEKSWK-CPHCVKI--------------YHIRKPYEKHLRDDHKLNE-------AEMKEIFKDVD 441
            .....| .|:.:.|              |...||...|::.:..|:|       .|...:|   .
Zfish    93 YFADEKPAPYSLNINVILPNTTHLRTGLYRPNKPTVHHIKTEPGLDEPCGIQTLPEFTSVF---S 154

  Fly   442 VHAKLDEEVFK--CPICSKIYL-VEKRLVTHMKVHGED-GKLTFKCPCYCNLFFATKEQA----T 498
            |...::....|  .|:..:::: .::.....|.|...| ..:||......|...|.....    |
Zfish   155 VPQTVNSLFIKPEIPVTDELHIGPQQPSAYQMPVSSSDLTTMTFSHSQSMNGIGAPGRTMLNLNT 219

  Fly   499 EHARAQHKELLYCEKCDKYMTGHDSLKNHERNFHS--KKEPRSQ------QRNLICD-------- 547
            ....||..|.:..|          |...:....||  ...|.||      |..||..        
Zfish   220 VALTAQSAEFVMPE----------SFTYNSPQPHSLPPSPPNSQPGSPENQAELITSVAPPPPYQ 274

  Fly   548 -KCGKK---FTGRTSLSDHVRSDCGRLPLYGCSVCGKHLSTAGILKTHMLLHKADTP-------Y 601
             :.|.|   .|..:.:..|.:                     ||| |....::.:.|       :
Zfish   275 ARLGMKVGQMTPHSMIMAHGQ---------------------GIL-TGPRYNRRNNPELEKRRIH 317

  Fly   602 QCD--KCGKTFKVKAQYKSHLKTRHTDYKPYKCHL--CPKEYPYRESLLTHMTVHTGIKRFLCNN 662
            .||  .|.|.:...:..|:|.:| ||..|||:|..  |...:...:.|..|...|||.|.|.|..
Zfish   318 HCDFQGCNKVYTKSSHLKAHQRT-HTGEKPYRCSWEGCDWRFARSDELTRHYRKHTGAKPFKCIA 381

  Fly   663 CGKRFTCISNLQAHRKVH 680
            |.:.|:...:|..|.|.|
Zfish   382 CSRCFSRSDHLALHMKRH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370 2/20 (10%)
COG5048 <523..>672 CDD:227381 42/179 (23%)
C2H2 Zn finger 546..566 CDD:275368 4/31 (13%)
C2H2 Zn finger 575..595 CDD:275368 4/19 (21%)
C2H2 Zn finger 603..624 CDD:275368 7/22 (32%)
C2H2 Zn finger 632..652 CDD:275368 4/21 (19%)
C2H2 Zn finger 660..680 CDD:275368 6/19 (32%)
klf5lNP_001035016.2 COG5048 <226..>401 CDD:227381 48/207 (23%)
zf-C2H2 317..341 CDD:278523 7/24 (29%)
C2H2 Zn finger 324..341 CDD:275368 5/17 (29%)
zf-H2C2_2 333..>349 CDD:290200 8/16 (50%)
zf-C2H2 347..371 CDD:278523 5/23 (22%)
C2H2 Zn finger 349..371 CDD:275368 4/21 (19%)
zf-H2C2_2 363..388 CDD:290200 10/24 (42%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRQ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.