DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and CG17803

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster


Alignment Length:631 Identity:127/631 - (20%)
Similarity:202/631 - (32%) Gaps:222/631 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PPGGFECRHC--------DARFCHEE---ELTQHAKDEHGVTGAVAGQERKPFVCEKCGAEYKYQ 108
            ||...:||.|        ||:..::.   .|..|.|...||......:|....:|..|      |
  Fly    80 PPPASKCRTCFRIISRHEDAQDLYDRVNIALLHHIKVITGVWIQQGVKELPHHICSTC------Q 138

  Fly   109 EAYRR--HCRTKCGE-EKLPREESRPMECKCCYTRFSSASNLSKHRRSRPDTCGQPEYDSPGSSD 170
            |...:  ..|.||.: :|..|:.:.....:.|                                 
  Fly   139 ETVNKSMEFRAKCQQVDKKLRQTTEKYNIQIC--------------------------------- 170

  Fly   171 GMKKHKAFRKKDRNRDSDDEDTTSEESEDSDDDIPLASRLKTKLKQESQNSDSGDECP-DFEPNN 234
                       |...:|:.|:...|||......:.......::|..:|:.....|:.| |.||..
  Fly   171 -----------DEEMESELENVLYEESAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPTQ 224

  Fly   235 ---SEDDADASGFQLPPPAMVKVEAFDEEDFEYQDASMYVKTESTDIFSNEKDKLLDVLLNEGDG 296
               |||:.|             ::...|:|                 |:.|::|..:.:::    
  Fly   225 FSLSEDELD-------------LDRDTEKD-----------------FALEQNKSCNEIIS---- 255

  Fly   297 LKPFESLKVEQGAGILDEIAAVPLVEVAEEDVLELRGHQMEKPPGPRKRGRPPKEKIPVVKRKYR 361
               ....|.::..|.:|..|.|..|.:.|.:.|                    ||..|    || 
  Fly   256 ---IRKCKTKEEIGKVDHGAKVYKVVLGEYNSL--------------------KETAP----KY- 292

  Fly   362 KRNAPRSP----SPDDSSGTPKRVAKISKKELKERLKMINKMEKSWKCPHCVKIYHIRKPYEKH- 421
            ..:.|:.|    ||::.:  .:|..:|..|.|            ::.|..|...:..|...:.| 
  Fly   293 SLSLPKKPQLRVSPEEKN--RRRRERIQAKPL------------NYVCDKCGHTFRQRSQLQMHL 343

  Fly   422 LRDDHKLNEAEMKEIFKDVDVHAKLDEEVFKCPIC-SKIYLVEKRLVTHMKVHGEDGKLTFKCPC 485
            ||.:...|                     |:||.| .|.|.:..|.:                  
  Fly   344 LRHNRAKN---------------------FECPECPKKFYDLYTRNI------------------ 369

  Fly   486 YCNLFFATKEQATEHARAQHK--ELLYCEKCDKYMTGHDSLKNHERNFH-----------SKKEP 537
                          |.||.||  ....|..|::......|...|||:.|           ||:|.
  Fly   370 --------------HVRALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEG 420

  Fly   538 RSQQRNLICDKCGKKFTGRTSLSDHVRSDCGRLPLYGCSVCGKHLSTAGILKTHMLLHKADTPYQ 602
            .|:.   .|.:|.|.:|.:..|..|:....|..| :.|.:|....:....:|.|..||. ..|.:
  Fly   421 SSRH---YCTQCTKSYTSKKGLVLHMNFHNGSRP-FQCKICQMKFADPSAMKRHQALHD-KFPIR 480

  Fly   603 CDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTH 648
            ||.|.|.|.:::|...| :..||...|::|.:|...|.:|.:|..|
  Fly   481 CDICLKGFLLRSQLTKH-QDVHTGMHPHRCEICDVHYRHRYNLNKH 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368 8/31 (26%)
C2H2 Zn finger 98..117 CDD:275368 4/20 (20%)
C2H2 Zn finger 134..152 CDD:275368 1/17 (6%)
C2H2 Zn finger 511..532 CDD:275370 6/20 (30%)
COG5048 <523..>672 CDD:227381 40/137 (29%)
C2H2 Zn finger 546..566 CDD:275368 6/19 (32%)
C2H2 Zn finger 575..595 CDD:275368 4/19 (21%)
C2H2 Zn finger 603..624 CDD:275368 7/20 (35%)
C2H2 Zn finger 632..652 CDD:275368 6/17 (35%)
C2H2 Zn finger 660..680 CDD:275368
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 19/79 (24%)
COG5048 <323..528 CDD:227381 61/262 (23%)
zf-C2H2 324..346 CDD:278523 5/21 (24%)
C2H2 Zn finger 326..346 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..375 CDD:275368 9/52 (17%)
C2H2 Zn finger 383..401 CDD:275368 4/17 (24%)
C2H2 Zn finger 426..446 CDD:275368 6/19 (32%)
C2H2 Zn finger 454..474 CDD:275368 4/19 (21%)
C2H2 Zn finger 481..501 CDD:275368 7/20 (35%)
C2H2 Zn finger 509..528 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.