DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and CG7987

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_650375.1 Gene:CG7987 / 41768 FlyBaseID:FBgn0038244 Length:1283 Species:Drosophila melanogaster


Alignment Length:694 Identity:148/694 - (21%)
Similarity:238/694 - (34%) Gaps:163/694 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DARFCHEEELT----QHAKDE------HGVTGAVAGQE-----------RKPFVCEKCGAEYKYQ 108
            ||:...||.:|    ||...|      ..:.|..:.||           .:|:.|:.|...::.:
  Fly    88 DAQVVTEEVITDDWVQHQGAERVEIAAEQIAGISSSQELLDMEQDEYTALRPYPCDFCSRRFRKK 152

  Fly   109 EAYRRHCRTKCGEEKLPREESRPMECKCCYTRFSSASNLSKHRRSRPDTCGQPEYDSPGSSDGMK 173
            .....|        .|..:..||..||.|..|||..:.|..|.::..:  .|...|:..::....
  Fly   153 ATLNNH--------MLAHQNDRPHLCKLCGARFSRRAELISHFKAHAE--AQDAADAEAAAAAAD 207

  Fly   174 KHKAFR-KKDRNRDSDDEDTTSE--------ESEDSDDDI------------------------P 205
            ...|.: :....|..||.....|        |.|::..::                        |
  Fly   208 SSSAIKFEHQTQRQLDDHYYEQEWPLFQHQQEQENAQQNVHQQHQIVEEGGIQLVASYPDTVAQP 272

  Fly   206 LA------SRLKTKLKQESQN----SDSG--DECPDFEPNNSEDDADASGF-QLPPPAMVKVEAF 257
            .|      ||||.  |:||..    ||..  |..|..||..::.....|.| .:.||........
  Fly   273 AAPSRGRISRLKP--KEESSQFIVISDKSVEDSRPYMEPEPAQPVVTTSEFIAVEPPPQPNFPVL 335

  Fly   258 D-EEDFEYQDASMYVKTESTDIFSNEKDKLLDVLLNEGDGLKPFESLKVEQGAGILDEIAAVPLV 321
            | .:.|..|...:....|.. :.|:.|:..:|         .|||..:.::              
  Fly   336 DHSKPFVCQQCGLAFAREKA-LVSHTKNHRVD---------SPFECNQCQE-------------- 376

  Fly   322 EVAEEDVLELRGHQMEKPPGPRKRGRPPKEKIPVVKRKYRKRNAPRSPSPDDSSGTPKRVAKISK 386
              ...|...|:.||.                    ..::.:.|:...|:..:.||        |:
  Fly   377 --MFWDNSSLQEHQK--------------------THQFEESNSEYDPASAEESG--------SE 411

  Fly   387 KELKERLKMINKMEKSWKCPHCVKIYH----IRKPYEKHLRDDHKLNEAEMKEIFKDVDVHAKLD 447
            .|..|:|      ...:.|..|...:|    :|:..:.|.:...:.......::....||....|
  Fly   412 SEADEQL------YGEFYCNECGISFHRQDLLRRHAKMHCKPSDQAAVGSNSDVTAGGDVELAKD 470

  Fly   448 EEVFKCPICSKIYLVEKRLVTHMKVHGEDGKLTFKCPCYCNLFFATKEQATEHARAQHKELL--- 509
            .....|..|.|.:.....::.|.::|....  .||| ..|.:.|..::....|...:|...|   
  Fly   471 SSGHCCNTCGKSFPSALEMLAHAEIHARFP--PFKC-VLCGISFYEEQAIKRHLHTRHPSELNAN 532

  Fly   510 YCEKCDKYMTGHDSLKNHERNFHSKKEPRSQQRNLICDKCGKKFTGRTSLSDHVRSDCGRLPLYG 574
            .|..|.|......:|..|..: ||:::..|      |.||||.|..:..|..|:.|...:..:  
  Fly   533 SCVLCGKECRDRKALIKHAWD-HSREKCHS------CSKCGKNFHNKARLKRHMASHRDKSVV-- 588

  Fly   575 CSVCGKHLSTAGILKTHMLLHKADTP---YQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCP 636
            |.||.:.......|..|...|...||   :.|.:|||||..::..:.|::. ||..:||.|..|.
  Fly   589 CEVCQEEFPDGRTLSNHRHSHSTTTPGKLFPCLECGKTFGSRSSQQIHVRI-HTGERPYGCRYCW 652

  Fly   637 KEYPYRESLLTHMTVHTGIKRFLCNNCGKRFTCISNLQAHRKVH 680
            |.:....:|..|..:|||.|.:.|:.|.:.|.....|:.|.:.|
  Fly   653 KAFADGGTLRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSH 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368 8/26 (31%)
C2H2 Zn finger 98..117 CDD:275368 3/18 (17%)
C2H2 Zn finger 134..152 CDD:275368 8/17 (47%)
C2H2 Zn finger 511..532 CDD:275370 5/20 (25%)
COG5048 <523..>672 CDD:227381 45/151 (30%)
C2H2 Zn finger 546..566 CDD:275368 8/19 (42%)
C2H2 Zn finger 575..595 CDD:275368 5/19 (26%)
C2H2 Zn finger 603..624 CDD:275368 7/20 (35%)
C2H2 Zn finger 632..652 CDD:275368 5/19 (26%)
C2H2 Zn finger 660..680 CDD:275368 5/19 (26%)
CG7987NP_650375.1 C2H2 Zn finger 142..162 CDD:275368 4/27 (15%)
C2H2 Zn finger 170..186 CDD:275368 7/15 (47%)
COG5048 326..734 CDD:227381 96/444 (22%)
C2H2 Zn finger 343..363 CDD:275368 4/20 (20%)
C2H2 Zn finger 371..391 CDD:275368 4/55 (7%)
C2H2 Zn finger 424..444 CDD:275368 4/19 (21%)
C2H2 Zn finger 476..496 CDD:275368 4/19 (21%)
C2H2 Zn finger 504..523 CDD:275368 4/19 (21%)
C2H2 Zn finger 534..554 CDD:275370 5/20 (25%)
C2H2 Zn finger 562..582 CDD:275370 8/19 (42%)
C2H2 Zn finger 589..609 CDD:275368 5/19 (26%)
C2H2 Zn finger 620..640 CDD:275368 7/20 (35%)
C2H2 Zn finger 648..668 CDD:275368 5/19 (26%)
zf-H2C2_2 661..685 CDD:290200 9/23 (39%)
C2H2 Zn finger 676..696 CDD:275368 5/19 (26%)
C2H2 Zn finger 709..726 CDD:275371
Hph 921..>1017 CDD:290417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.