DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and CG3281

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:350 Identity:88/350 - (25%)
Similarity:144/350 - (41%) Gaps:61/350 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 YEKHLRDDH---------KLNEAEMKEIFKDVDVHAKLDEE---VFKCPICSKIYLVEKRLVTHM 470
            |....|||.         :.:|.|.:|:.:...:.::|:..   ::||.:|.:::...:.|..|.
  Fly   158 YASEDRDDEPEDSFQLKPRPDEIENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKSESLTRHF 222

  Fly   471 -KVHGEDGKLTFKCPCYCNLFFATKEQATEHARAQHKELLYCEKCDKYMTGHDSLKNHERNFH-- 532
             :.|    |||..        .|..:.|.|....   .||.||.|.:.....|:|:.|.:.||  
  Fly   223 SQAH----KLTAD--------VAAMKLANESCGT---GLLTCEHCPRTFKRQDTLRRHMQAFHPD 272

  Fly   533 ------------SKKEPRSQQRNLICDKCGKKFTGRTSLSDHVRSDCGRLPLYGCSVCGKHLSTA 585
                        |.::..:::|:  |..||..|. .:||:.|:|...|..| |.|..|.|....:
  Fly   273 AIALEPEETTDNSARKRIAKRRD--CPHCGLSFP-VSSLTIHIRRHTGDNP-YKCDQCEKAFPRS 333

  Fly   586 GILKTHMLLHKADTPYQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTHMT 650
            ..|..||..|..:.|.:|..|.|.|..:.:...|::. ||..:||.|.:|.|.:.....|..||.
  Fly   334 QDLSLHMRQHTGERPSECKICSKKFISQNKLARHMRL-HTGQRPYSCKMCSKSFVQSNDLKIHMR 397

  Fly   651 VHTGIKRFLCNNCGKRFTCISNLQAHR-------------KVHADTCGQLPLNAKATQYMGVQRG 702
            .|||.:.:.|..||:.|.|.|:|..||             :|.|:......:||:..|.......
  Fly   398 RHTGERPYQCGVCGESFVCGSHLNIHRNRKGHLIAVIPGNEVEANFAADPYVNARVNQRRSEDIE 462

  Fly   703 KLLMGAKPEAGMEYEETKTLIAQDV 727
            ::.:...||..:: :..:.|...||
  Fly   463 RMRLQRIPENQLQ-QRLENLPKPDV 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370 6/20 (30%)
COG5048 <523..>672 CDD:227381 48/162 (30%)
C2H2 Zn finger 546..566 CDD:275368 8/19 (42%)
C2H2 Zn finger 575..595 CDD:275368 6/19 (32%)
C2H2 Zn finger 603..624 CDD:275368 5/20 (25%)
C2H2 Zn finger 632..652 CDD:275368 6/19 (32%)
C2H2 Zn finger 660..680 CDD:275368 9/32 (28%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 4/20 (20%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 32/101 (32%)
C2H2 Zn finger 296..315 CDD:275368 8/19 (42%)
zf-H2C2_2 307..330 CDD:290200 10/23 (43%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
zf-H2C2_2 335..358 CDD:290200 8/22 (36%)
C2H2 Zn finger 351..371 CDD:275368 5/20 (25%)
zf-H2C2_2 364..388 CDD:290200 8/24 (33%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
zf-H2C2_2 391..416 CDD:290200 10/24 (42%)
C2H2 Zn finger 407..424 CDD:275368 7/16 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.