DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and CG6791

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:913 Identity:172/913 - (18%)
Similarity:290/913 - (31%) Gaps:325/913 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SMAPSSSAAAAATKLLVEITTD-GIPKLHCPVCN---KALVSLAGYVKHVKKHQPPGGF------ 59
            |:.|::|...|..:..|.|..: |:..: ||.|.   :.......::.|:.|:....|.      
  Fly   139 SVRPTTSQINATDENGVPINYELGVVYI-CPACGGEFRQQDHWKRHMNHIHKYNTLRGLNFTPLD 202

  Fly    60 ----ECRHCDARFCHEEELTQHAKD---EHGVTGAVAGQERKPFVCEK---CGAEYKYQEAYRRH 114
                .||.|:.|      :..|:::   :|..|       ..||.|.|   |..||||::....|
  Fly   203 KLYQRCRECNKR------IAMHSRENLLKHKFT-------HLPFRCTKCYICKREYKYRQDLMVH 254

  Fly   115 CR-TKCGEEKLPREESRPMECKCCYTRFSSASNLSKHRRSRPDTCGQPEYDSPGSSDGMKKHKAF 178
            .| ..|.|......|.           :::|...::.|.||              ::.:.:.|:|
  Fly   255 LRMVHCDEVVAMMREG-----------YNAAGRKTRVRESR--------------TEQLLREKSF 294

  Fly   179 RKKD-----------RNR----DSDD----EDTTSEE--------------------------SE 198
            |:.|           ||.    |:|:    |.|.|||                          ..
  Fly   295 RENDDLGEESDRIEVRNELLEPDADESGTQEQTVSEEVSKKKAGTRGAAELCEDYIHYMCPDCGT 359

  Fly   199 DSDDDIPLASRLK---TKLKQESQNSDSGD------ECPDFEPNNSEDDADASGF-QLPPPAMVK 253
            |.|.....:..::   ..:.:...|..|.|      ||......|:.....|..| .|..|..::
  Fly   360 DCDTHAQWSQHIEFVHDYVSRRGLNFRSVDMQMQCLECKKIVTPNTIKSLRAHKFSHLSQPEWLR 424

  Fly   254 VEAFDEEDFEYQDASMYVKTESTDIFSNEKDKLLDVLLNEGDGLKPFESLKVE--------QGAG 310
            .:...:...::|:...::      :..:..|.|:.....|.||..| .:::.|        :|.|
  Fly   425 CKLCYKGYTDHQEIIRHL------LQQHHMDTLMSEDAEEEDGDAP-SAIEDECDGDNGNGEGNG 482

  Fly   311 I-LDEIAAVPLVEVAEEDVLELRGHQMEKPPGPRKRGRPPKEKI--------------PVVKRKY 360
            . |||.:  |..|.|                 ||:.||...:.|              ..:::|:
  Fly   483 APLDEDS--PYFEDA-----------------PRRGGRISSDDIFEPHIDYLCPQCGKEFIEKKH 528

  Fly   361 RKRNAPRSPSPDDSSGTPKRVAKISKKELKERLKMINKMEKSWKCPHCVKIYHIRKPYEKHLRDD 425
            .:.:...:.|.:|.|              |...:|||  |:..||..|.||  |...|.......
  Fly   529 WRTHVVMAHSMNDLS--------------KLNFEMIN--ERQLKCTECDKI--ITNAYGIQNAQQ 575

  Fly   426 HKLNEAEMKEIFKDVDVHAKLDEEVFKCPICSKIYLVEKRLVTHMKVHGEDG---KLTFKCPCYC 487
            |::.....|       .:|       :|..|.|.|...|.||.|:..|...|   ||:..||  .
  Fly   576 HRITHLPFK-------AYA-------RCRKCHKSYTDRKGLVKHLATHHRVGWPRKLSGGCP--A 624

  Fly   488 NLFFATKEQATEHARAQHK--ELLYCEKCDKYMTGHDS-----LKNHERNFHSKKEPRS-----Q 540
            .:....|:...:.....::  |::|.:..|:.....|:     ::..|..:.....|.|     |
  Fly   625 PILTPAKQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDFGEQMQAEEDEYPIAPPPPSPPPPPQ 689

  Fly   541 QRNLICDKCGKKFTGRTSLSDHVRSDCGRLPLYGCSVCGKHLSTAGILKTHM------------- 592
            .               |:..:|.|        |.|..||...:|...::.|:             
  Fly   690 P---------------TTQGNHQR--------YKCVHCGTLFATQAAVRVHISEKRCRKTVVRRR 731

  Fly   593 ---LLHKADTP---------YQCDKCGKTFKVKAQYKSH------------LKTRHTDYKPYKCH 633
               ::..||..         :.|..||..:|.:.:::.|            |..|..|...|:|.
  Fly   732 RQPVMSSADPSVPTVEQNYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQYLNMRQLDKYRYQCT 796

  Fly   634 LCP-----------KEYPYRESLLTHMTVHTGIKRFLCNNCGKRFTCISNLQAH-RKVHADTCGQ 686
            .|.           :::.:|     |:.....:|..:|..|   :....|:.|| |..|:....:
  Fly   797 QCKDIVCNSKLKGLQDHHFR-----HLPYRLYLKCLICGTC---YNHKPNIAAHLRARHSIFDRE 853

  Fly   687 LP-LNAKATQYMGVQRGKLLMGAKPEAGMEYEETKTLIAQDVIDRDMPMAQELNFPSDGSAP-LA 749
            .| :..|..|.:|                .|::.         .|:.|     ..||...|| ||
  Fly   854 TPTMITKPKQVLG----------------RYKDN---------SRENP-----KLPSPPPAPALA 888

  Fly   750 TVP 752
            ..|
  Fly   889 PAP 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368 4/22 (18%)
C2H2 Zn finger 61..82 CDD:275368 5/23 (22%)
C2H2 Zn finger 98..117 CDD:275368 9/22 (41%)
C2H2 Zn finger 134..152 CDD:275368 1/17 (6%)
C2H2 Zn finger 511..532 CDD:275370 3/25 (12%)
COG5048 <523..>672 CDD:227381 31/206 (15%)
C2H2 Zn finger 546..566 CDD:275368 3/19 (16%)
C2H2 Zn finger 575..595 CDD:275368 5/35 (14%)
C2H2 Zn finger 603..624 CDD:275368 6/32 (19%)
C2H2 Zn finger 632..652 CDD:275368 4/30 (13%)
C2H2 Zn finger 660..680 CDD:275368 6/20 (30%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368 4/20 (20%)
C2H2 Zn finger 208..230 CDD:275368 7/34 (21%)
C2H2 Zn finger 235..256 CDD:275368 8/20 (40%)
C2H2 Zn finger 516..532 CDD:275368 1/15 (7%)
C2H2 Zn finger 557..580 CDD:275368 7/24 (29%)
C2H2 Zn finger 589..609 CDD:275368 8/19 (42%)
COG5236 <939..>1096 CDD:227561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.