DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and CG10654

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:274 Identity:69/274 - (25%)
Similarity:106/274 - (38%) Gaps:73/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 IFKDVDVHAKLDEEVF--------------KCPICSKIYLVEKRL-VTHMKVHGEDGKLTFKCP- 484
            |...:.:.|.|:|||:              |..|.||:....||. |.|          |.:|. 
  Fly   176 ILSRITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVRH----------TLECRI 230

  Fly   485 CYCNLFFATKEQATEHARAQHKEL--LYCEKCDKYMTGHDSLKNHERNFHSKKEPRSQQRNLICD 547
            |:...:   |....|....||:.|  ..|..|.|.....:.|::|.|..|:..:  :.:....|.
  Fly   231 CHRGFY---KPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNAD--AARIIYACP 290

  Fly   548 KCGKKFTGRTSLSDHVRSDCGRLPLYGCSVCGKHLSTAGILKTHMLLHKADTP---YQCDKCGKT 609
            .|.|.:|...||..|:|                        :||...|::::|   :.|::|||.
  Fly   291 SCNKVYTANRSLKYHMR------------------------RTHERYHESESPDARHICEECGKC 331

  Fly   610 FKVKAQYKSHLKTRH------TDYKPYKCHLCPKEYPYRESLLTHMTVHTGIKRFL--CNNCGKR 666
            |..||    || |||      .:.:.|.|..|.:.:..:|:::.|:....|.|..|  |..||:.
  Fly   332 FARKA----HL-TRHKMVHGSVEGRRYCCECCDRRFYTKENMVDHLLRKHGNKNLLLRCRKCGRI 391

  Fly   667 FTCISNLQAHRKVH 680
            |.....|.||.:.|
  Fly   392 FQNSVELNAHGRKH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370 6/20 (30%)
COG5048 <523..>672 CDD:227381 40/159 (25%)
C2H2 Zn finger 546..566 CDD:275368 8/19 (42%)
C2H2 Zn finger 575..595 CDD:275368 2/19 (11%)
C2H2 Zn finger 603..624 CDD:275368 10/20 (50%)
C2H2 Zn finger 632..652 CDD:275368 4/19 (21%)
C2H2 Zn finger 660..680 CDD:275368 7/19 (37%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 4/22 (18%)
C2H2 Zn finger 256..313 CDD:275368 17/82 (21%)
C2H2 Zn finger 289..314 CDD:275368 10/48 (21%)
zf-C2H2 323..345 CDD:278523 12/26 (46%)
C2H2 Zn finger 325..345 CDD:275368 12/24 (50%)
C2H2 Zn finger 355..376 CDD:275368 4/20 (20%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.