DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and CG2199

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster


Alignment Length:711 Identity:126/711 - (17%)
Similarity:231/711 - (32%) Gaps:227/711 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RKPFVCEKCGAE------YKYQEAYRRHCRTKCGEEKLPREESRPMECKCCY----TRFSSASNL 147
            :|...|:.||..      :..|:.:.....|...|....|.....:..|.|:    |..|||:.:
  Fly    14 QKEVRCDHCGTSQGSKSVFSGQKVFLGRKITDVLETITHRSIPSSLPIKICFVCTSTFMSSAALI 78

  Fly   148 SKHRRSRPDTCGQPEYDSPGSSDGMKKHKAFRKKDRNRDSDDEDTTSEESEDSDDDIPLASRLKT 212
            .|.|.:......||          .||.|.         ::.|:.:::||:.....:|   :..|
  Fly    79 EKVRETVDRVQEQP----------AKKTKV---------AEIEEPSTQESDKKAVKVP---KKNT 121

  Fly   213 KLKQESQNSDSGDECPDFEPNNSEDDADASGFQLPPPAMVKVEAFDEEDFEYQDASMYVKTESTD 277
            .|:|.|::                    .:.|   ||:.|                         
  Fly   122 TLRQRSKS--------------------IAAF---PPSFV------------------------- 138

  Fly   278 IFSNEKDKLLDVLLNEGDGLKPFESLKVEQGAGILDEIAAVPLVEVAEEDVLELRGHQMEKPPGP 342
                                         .||....||..:                    ...|
  Fly   139 -----------------------------NGANTNTEIEII--------------------SASP 154

  Fly   343 RKRGRPPKEKIPVVKRKYRKRNAPRSPSPDDSSGTPKRVAKISKKELKERLKMINKMEK------ 401
            :|..:.||::|..:.......:...:|:.:.|| |.|....:......:.::::.:.|:      
  Fly   155 KKLDKTPKKQISRLFEDNLNDSVKLTPAKEVSS-TKKAFLNLFGNGGNDAIEVLTESEEEEDSDK 218

  Fly   402 --------SWKCPHCVKIYHIR--KPYEKHLRDDHKLNEAEMKEIFKDVDVHAKLDEEVFKCPIC 456
                    :::||.|.  :|.:  |||::||:.:|.|..                 ..::.|.:|
  Fly   219 GPITINTNNFQCPECE--FHAKFPKPYKEHLQKEHGLQR-----------------PRIYPCTLC 264

  Fly   457 SKIYLVEKRLVTHMK-VHGEDGKLTFKCPCYCNLFFATKEQATEHAR----AQHKEL-------- 508
            .|.:.|.|.|..|:: .|..    ||:.........:.:::|...|:    |:.||.        
  Fly   265 IKTFGVLKTLKNHLRDTHSR----TFESEAKTKAKESKEKEAKSGAKNKIDAKAKETNAVSQRKK 325

  Fly   509 ------------LYCEKCDKYMTGHDSLKNHERNFHSKKEPRSQQRNLICDKC-GKKFTGRTSLS 560
                        :.|....|.:...|...|:::...|:...::|...:...|. .:....:..|.
  Fly   326 PKEKKSKEKKTEIKCNVETKVVDEIDDQVNNKKGTDSEDADQTQATKIASFKALNESLMKKRMLE 390

  Fly   561 DHVRSDCGRLPLYGCSVCGKHLSTAGILKTHMLLHKADT-PYQCDKCGKTFKVKAQYKSHLKTRH 624
            :.:.|:      |..::.|...||.          :||: .:||:.|........|.:.|:||.|
  Fly   391 NVIDSE------YTFAINGSSASTP----------RADSNNFQCEICDCELMTAKQMQEHMKTVH 439

  Fly   625 TDYKP--YKCHLCPKEYPYRESLLTHMTVHT-GIKRFLCNNCGKRFTCISNLQAHRKVHADTCGQ 686
            :..||  :|||:|.|....::||.||||:|. |.:   ..|..||     .:........|..|.
  Fly   440 SIDKPKVFKCHVCEKSLATKQSLKTHMTLHADGAE---APNSSKR-----KILQDEDEDVDILGT 496

  Fly   687 LPLNAKATQYMGVQRGKLLMGAKPEAGMEYEETKTLIAQDVIDRDMPMAQELNFPSDGSAP 747
            ..:...|.:..|.::.:    ..|....::...|.|..:|.:...:...:..|...|...|
  Fly   497 TQIENTAEKVEGPKKSQ----QSPTKAAKFTNRKILQEEDEVVEIVDAFKTDNTAEDDEGP 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368 4/24 (17%)
C2H2 Zn finger 134..152 CDD:275368 7/21 (33%)
C2H2 Zn finger 511..532 CDD:275370 4/20 (20%)
COG5048 <523..>672 CDD:227381 38/153 (25%)
C2H2 Zn finger 546..566 CDD:275368 2/20 (10%)
C2H2 Zn finger 575..595 CDD:275368 3/19 (16%)
C2H2 Zn finger 603..624 CDD:275368 6/20 (30%)
C2H2 Zn finger 632..652 CDD:275368 10/19 (53%)
C2H2 Zn finger 660..680 CDD:275368 3/19 (16%)
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 6/20 (30%)
C2H2 Zn finger 449..469 CDD:275370 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.