DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and az2

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:605 Identity:126/605 - (20%)
Similarity:202/605 - (33%) Gaps:180/605 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 MKKHKAFRKKDRNRDSDDEDTTSE--ESEDSDDDIPLASRLKTKLKQE-SQNSDSGDECPDFEPN 233
            :|:|     .:.|.....|.||||  .|...::::   |..|..:.:| .:|..:.|...|..|:
  Fly    42 VKEH-----LEANPSMQQELTTSEVISSAKCEEEV---SPAKVFIVEEPPENCLAEDMFVDVPPS 98

  Fly   234 NSEDDADASGFQLPPPAMVKVEAFDEEDFEYQDASMYVKTESTDIFSNEKDKLLDVLLNEGDGLK 298
            :..|::.:           .||..:|||.|...:||.|..|                        
  Fly    99 SENDESTS-----------PVEEEEEEDDEVDSSSMTVDCE------------------------ 128

  Fly   299 PFESLKVEQGAGILDEIAAVPLVEVAEEDVLELRGHQMEKPPGPRKRGRPPKEKIPVVKRKYRKR 363
                      .|..:.....||.:.                 .|....|.|  :|......|:::
  Fly   129 ----------LGTRNSTHFAPLTKF-----------------NPTFYRRSP--RITQFIELYKQQ 164

  Fly   364 NAPRSPSPDDSSGTPKRVAKISKKELKERLK-MINKMEKSWKCPHCVKIYH-------------- 413
            .....|:  |.|...|.....:.:||.|:|| .:|....::|...|:...|              
  Fly   165 TCLWDPA--DESYRDKEKRANAYEELLEQLKATVNLHLTAYKLKKCITSLHAQYASISRQKKTQK 227

  Fly   414 -IRKPYEKH-----LRDDHKLNEAEMKEIFKD-----------------VDVHAK---LDEEVFK 452
             .:.|...|     |.:...|.:|:..::..|                 :|:::|   |.:...|
  Fly   228 LTKVPLYYHGKYSFLAERGSLEDADSDDVDGDGKIKLVFTEENQLTTQFIDLYSKFPQLYDPAHK 292

  Fly   453 --CPI-CSKIYLVE----------KRLVTHMKVHGEDG------------KLTFKCPCY------ 486
              |.: ..|..|:|          ..||||..|:  |.            |......|.      
  Fly   293 HFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDVY--DSIQSMRQWYSRRIKTLTDVQCVGLSLAE 355

  Fly   487 ------CNLFFATKEQATEHARAQHKELLYCEKCDKYMTGHDSLKNHERNFHSKKEPRSQQRNLI 545
                  ||.|..||         ..::.|.||.|:...:...:|:.|:...|...:....:    
  Fly   356 KQYIERCNSFMPTK---------SFRQKLKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFR---- 407

  Fly   546 CDKCGKKFTGRTSLSDH---VRSDCGRLPLYGCSVCGKHLSTAGILKTHMLLH---KADTPYQCD 604
            |..|...|..:..|..|   |..|    ..:.|.:|.:..:....|..|...|   ....|:.|:
  Fly   408 CTLCELNFDRKCHLQQHSQRVHMD----KSFVCEICSRSFAFGNQLAIHKRTHDEKHVAKPFVCE 468

  Fly   605 KCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTHMTVHTGIKRFLCNNCGKRFTC 669
            .|||.||.|.|..:|:...||..:.:||.:|||::..:..|..|:..|..|:..:|..|.|.||.
  Fly   469 FCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTN 533

  Fly   670 ISNLQAHRKVHADTCGQLPL 689
            .:.|..||.:|.:...|..|
  Fly   534 ANALVKHRHIHKEKTLQCSL 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370 5/20 (25%)
COG5048 <523..>672 CDD:227381 41/154 (27%)
C2H2 Zn finger 546..566 CDD:275368 6/22 (27%)
C2H2 Zn finger 575..595 CDD:275368 4/19 (21%)
C2H2 Zn finger 603..624 CDD:275368 9/20 (45%)
C2H2 Zn finger 632..652 CDD:275368 6/19 (32%)
C2H2 Zn finger 660..680 CDD:275368 8/19 (42%)
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510 16/86 (19%)
GT1 276..>341 CDD:304916 14/66 (21%)
C2H2 Zn finger 377..398 CDD:275368 5/20 (25%)
C2H2 Zn finger 408..429 CDD:275368 5/20 (25%)
C2H2 Zn finger 436..456 CDD:275368 4/19 (21%)
C2H2 Zn finger 467..488 CDD:275368 9/20 (45%)
C2H2 Zn finger 496..516 CDD:275368 6/19 (32%)
C2H2 Zn finger 524..544 CDD:275368 8/19 (42%)
C2H2 Zn finger 551..572 CDD:275368 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440033
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.