DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and CG30431

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:194 Identity:59/194 - (30%)
Similarity:93/194 - (47%) Gaps:14/194 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 KEQATEHARAQHKELLYCEKCDKYMTGHDSLKNHERNFHSKKEPRSQQRNLICDKCGKKFTGRTS 558
            |.....|.|:.|.    |.:|:|..|.:..||.|....|...|.|.|     |::|.|.|..|.|
  Fly   221 KASGAVHPRSLHP----CPECEKKFTRNFQLKLHMTAVHGMGEMRYQ-----CEECRKNFASRHS 276

  Fly   559 LSDHVRSDCGRLPLYGCSVCGKHLSTAGILKTHMLLHKADTP---YQCDKCGKTFKVKAQYKSHL 620
            |..||:|.......:||..|.:.......|.:|:..|..:..   ::|.:|.|::..|:..::|:
  Fly   277 LRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHM 341

  Fly   621 KTRHTDY-KPYKCHLCPKEYPYRESLLTHMTVHTGIKRFLCNNCGKRFTCISNLQAHR-KVHAD 682
            ::.:.:. :|:||..|.|.:..|..|.:|:.||||.|.|.|..|.|.:..:.||..|. ::|||
  Fly   342 RSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLHAD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370 7/20 (35%)
COG5048 <523..>672 CDD:227381 45/152 (30%)
C2H2 Zn finger 546..566 CDD:275368 9/19 (47%)
C2H2 Zn finger 575..595 CDD:275368 4/19 (21%)
C2H2 Zn finger 603..624 CDD:275368 5/20 (25%)
C2H2 Zn finger 632..652 CDD:275368 6/19 (32%)
C2H2 Zn finger 660..680 CDD:275368 6/20 (30%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 7/20 (35%)
C2H2 Zn finger 264..285 CDD:275368 10/20 (50%)
C2H2 Zn finger 293..313 CDD:275368 4/19 (21%)
zf-C2H2_8 305..373 CDD:292531 16/67 (24%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 11/22 (50%)
C2H2 Zn finger 382..403 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.