DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and Plzf

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:513 Identity:106/513 - (20%)
Similarity:171/513 - (33%) Gaps:157/513 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 DSDDDIPLASRLKTKLKQESQNSDSGDECPDFEPNNSEDDADASGFQLPPPAMVKVEAFD----- 258
            ||||.:.|:... ..|..:||..:|..:...|..:|              |..:.:..|.     
  Fly    42 DSDDSLSLSVHF-CVLAAQSQFINSNQKQQQFSIHN--------------PLKITIRNFSCTQCL 91

  Fly   259 --EEDFEYQDASMYVKTESTDIFSNEKDKLLDV--LLNEGDGLKPFESLKVEQGAGILDEIAAVP 319
              ..||.|:|  :...::..::...|..::|.|  |||          |...|..|...|...:|
  Fly    92 HTIVDFFYED--LVSVSKEHELHFRELAQILAVTELLN----------LYQLQPLGEAKEATEIP 144

  Fly   320 LVEVAEEDVLELRGHQMEKPPGPRKRGRPPKEKIPVV---KRKYRKRNAPRSPSPDDSSGTPKRV 381
                               .||..:....|::|...|   ::.|.|...||:             
  Fly   145 -------------------APGEAQPNPDPEKKAEAVFENRQSYFKLKNPRA------------- 177

  Fly   382 AKISKKELKERLKMINKMEKSWKCPHCV----KIYHIRKPYEKHLRDDHKLNEAEMKEIFKDVDV 442
                             ::.|.|..:|:    |.|.::|..|       .:...|...:.     
  Fly   178 -----------------VKSSSKVNYCIGCDFKCYQVQKMIE-------HMGSCEPSHLI----- 213

  Fly   443 HAKLDEEVFKCPICSKIYLVEKRLVTHMKVHGEDGKLTFKCPCYCNLFFATKEQATEHARAQHKE 507
                      |.:|...:|..:...||::.|..|.:..|.| ..|.:.|.|:.....|   |.| 
  Fly   214 ----------CSLCEVGFLDWREYDTHLRRHSGDLRKPFFC-LQCGIRFNTRAALLVH---QPK- 263

  Fly   508 LLYCEKCDKYMTGHDSLKNHERNFHSKKEPRSQQRNLICDKCGKKFTGRTSLSDHVRSDCGRLPL 572
                                    ||.:.|.      ||..|||.|..:..||:|:........:
  Fly   264 ------------------------HSTETPH------ICPHCGKGFKWKQGLSNHILVHNPEKQM 298

  Fly   573 YGCSVCGKHLSTAGILKTHMLLHKADTPYQCDKCGKTFKV--KAQYKSHLKTRHTDYKPYKCHLC 635
            . |.|||...:....||:|.|||..:. :.|...|...:.  |...|.|::| |...:.:.|.:|
  Fly   299 L-CDVCGYSTTHMKALKSHKLLHTGEF-FACTVSGCKHRANRKENLKLHIET-HKQGRDFICEVC 360

  Fly   636 PKEYPYRESLLTHMTVHT--GIKRFLCNNCGKRFTCISNLQAH-RKVHADTCGQLPLN 690
            ..::...::|..|...||  |..|:.|..||........::.| ::||.:...||.|:
  Fly   361 GCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRVHTEKPVQLELS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370 0/20 (0%)
COG5048 <523..>672 CDD:227381 40/152 (26%)
C2H2 Zn finger 546..566 CDD:275368 8/19 (42%)
C2H2 Zn finger 575..595 CDD:275368 8/19 (42%)
C2H2 Zn finger 603..624 CDD:275368 6/22 (27%)
C2H2 Zn finger 632..652 CDD:275368 4/19 (21%)
C2H2 Zn finger 660..680 CDD:275368 4/20 (20%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 60/269 (22%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 7/48 (15%)
C2H2 Zn finger 272..292 CDD:275368 8/19 (42%)
C2H2 Zn finger 300..320 CDD:275368 8/19 (42%)
C2H2 Zn finger 330..349 CDD:275368 5/19 (26%)
C2H2 Zn finger 357..377 CDD:275368 4/19 (21%)
C2H2 Zn finger 387..408 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.