DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and CG2120

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:244 Identity:64/244 - (26%)
Similarity:89/244 - (36%) Gaps:76/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   540 QQRNLI----CDKCGKKFT-----GRTSLSDHVRSDCGRLPLYGCSVCGKHLSTAGILKTHMLLH 595
            ||||..    .|.|..|.|     .||:..||.           |.:|.:..|.|..|:.|.:.|
  Fly    68 QQRNTTEHKPTDMCKPKRTPTTKRHRTTGKDHT-----------CDICDRRFSEAYNLRIHKMTH 121

  Fly   596 KADTPYQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTHMTVHTGIKRFLC 660
            ..:.|:.|.:|||.|:...:.:.|..| ||..:|:||.:|.|.:.|...|..|..:|||.|.:.|
  Fly   122 TDEKPHVCVECGKGFRQLNKLRIHAVT-HTAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPC 185

  Fly   661 --NNCGKRFTCISNLQAHRKV-HADTCGQLPLNAKATQYMGVQRGKLLMGAKPEAGMEYEETKTL 722
              .:|...|..|...:.|.|: ||                                         
  Fly   186 LATDCHLSFHSIHARRIHTKLRHA----------------------------------------- 209

  Fly   723 IAQDVIDRDMPMAQELNFPSDGSAPLATVPL--------NYASTHLVPH 763
             ||...|.:.|:|::..  .|.||...|.|:        .|.|.||..|
  Fly   210 -AQTDPDPEHPLAEQEQ--RDTSALSFTCPVCSRVLTDQCYLSIHLKRH 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370
COG5048 <523..>672 CDD:227381 45/142 (32%)
C2H2 Zn finger 546..566 CDD:275368 8/24 (33%)
C2H2 Zn finger 575..595 CDD:275368 6/19 (32%)
C2H2 Zn finger 603..624 CDD:275368 7/20 (35%)
C2H2 Zn finger 632..652 CDD:275368 6/19 (32%)
C2H2 Zn finger 660..680 CDD:275368 6/22 (27%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 6/19 (32%)
zf-H2C2_2 113..138 CDD:290200 9/24 (38%)
C2H2 Zn finger 129..149 CDD:275368 7/20 (35%)
zf-H2C2_2 142..166 CDD:290200 9/24 (38%)
COG5048 151..>264 CDD:227381 35/149 (23%)
C2H2 Zn finger 157..177 CDD:275368 6/19 (32%)
C2H2 Zn finger 185..206 CDD:275368 5/20 (25%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368
C2H2 Zn finger 293..313 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.