DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and CG11398

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:271 Identity:62/271 - (22%)
Similarity:106/271 - (39%) Gaps:55/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 HLRDDHK--LNEAEMK-EIFKDVDVHAKLDEEVFKCPICSKIYLVEKRLVTHMKVHGEDGKLTFK 482
            |..:|.:  ||..|:: |...:...|.:.....|.|..|..::|..:.|..|...|...|     
  Fly    17 HTYEDEELSLNTEELQFEELNERSQHQQGGSPSFVCRRCPALFLTREELAAHRPTHRYQG----- 76

  Fly   483 CPCYCNLFFATKEQATEHARAQHKELLYCEKCDKYMTGHDSLKNHERNFHSKKEPRSQQRNLICD 547
                     ..:..|:|||         |:.|.:....|::|.:| .|.|      :..||..|.
  Fly    77 ---------GQQTPASEHA---------CDACGRVFQKHNALVDH-MNAH------NDVRNYPCP 116

  Fly   548 KCGKKFTGRTSLSDHVRSDCGRLPLYGC------------SVCGKHLSTAGILKTHMLLHKADTP 600
            :|..:|..|::...|:::...::.|:.|            ..|.:|:.|         :|:.:..
  Fly   117 ECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKT---------VHQNERN 172

  Fly   601 YQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTHMTVHTGIKRFLCNNCGK 665
            ..||.|...|.....|:.||.: |...|.|.|.:|.|.:...|:...|:.||:..|.::|:.||.
  Fly   173 LVCDTCSARFSHPVNYRKHLAS-HGSAKSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGA 236

  Fly   666 RFTCISNLQAH 676
            .:...:.|..|
  Fly   237 DYMRRNQLIRH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370 6/20 (30%)
COG5048 <523..>672 CDD:227381 38/160 (24%)
C2H2 Zn finger 546..566 CDD:275368 5/19 (26%)
C2H2 Zn finger 575..595 CDD:275368 4/31 (13%)
C2H2 Zn finger 603..624 CDD:275368 7/20 (35%)
C2H2 Zn finger 632..652 CDD:275368 5/19 (26%)
C2H2 Zn finger 660..680 CDD:275368 5/17 (29%)
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 5/19 (26%)
C2H2 Zn finger 87..107 CDD:275368 6/20 (30%)
C2H2 Zn finger 115..136 CDD:275368 5/20 (25%)
C2H2 Zn finger 144..165 CDD:275368 3/20 (15%)
C2H2 Zn finger 175..195 CDD:275368 7/20 (35%)
C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.