DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zf30C and klf-2

DIOPT Version :9

Sequence 1:NP_477301.1 Gene:zf30C / 34292 FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_507995.2 Gene:klf-2 / 186179 WormBaseID:WBGene00009998 Length:299 Species:Caenorhabditis elegans


Alignment Length:176 Identity:39/176 - (22%)
Similarity:64/176 - (36%) Gaps:60/176 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 MTGHDS------LKNHERNFH--SKKEPR---SQQRNLICDKCGKKFTGRTSLSDHVRSDCGRLP 571
            ::|.|.      ||:..|.:|  |.::|:   |::|:                    ::...||.
 Worm   152 LSGKDEEDPRIPLKDRGRVYHPQSTEKPKKVPSKRRD--------------------KATLDRLR 196

  Fly   572 LYGC--SVCGKHLSTAGILKTHMLLHKADTPYQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHL 634
            ::.|  ..|||..:.:..|..|..:|..:.||.|:..|                           
 Worm   197 VHKCFYQGCGKVYTKSSHLTAHERVHSGEKPYPCEWPG--------------------------- 234

  Fly   635 CPKEYPYRESLLTHMTVHTGIKRFLCNNCGKRFTCISNLQAHRKVH 680
            |...:...:.|..|...|||.|.|.|..|.::|:...:||.|.|.|
 Worm   235 CSWRFARSDELTRHYRKHTGAKPFACKECSRKFSRSDHLQLHMKRH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368
C2H2 Zn finger 511..532 CDD:275370 5/19 (26%)
COG5048 <523..>672 CDD:227381 32/161 (20%)
C2H2 Zn finger 546..566 CDD:275368 0/19 (0%)
C2H2 Zn finger 575..595 CDD:275368 6/21 (29%)
C2H2 Zn finger 603..624 CDD:275368 2/20 (10%)
C2H2 Zn finger 632..652 CDD:275368 3/19 (16%)
C2H2 Zn finger 660..680 CDD:275368 7/19 (37%)
klf-2NP_507995.2 C2H2 Zn finger 205..222 CDD:275368 5/16 (31%)
C2H2 Zn finger 230..252 CDD:275368 5/48 (10%)
zf-H2C2_2 244..269 CDD:290200 10/24 (42%)
C2H2 Zn finger 260..280 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRQ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.