DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment zf30C and Klf5

DIOPT Version :9

Sequence 1:	NP_477301.1	Gene:	zf30C / 34292	FlyBaseID:	FBgn0270924	Length:	777	Species:	Drosophila melanogaster
Sequence 2:	NP_033899.2	Gene:	Klf5 / 12224	MGIID:	1338056	Length:	446	Species:	Mus musculus

Alignment Length:	82	Identity:	30/82 - (36%)
Similarity:	39/82 - (47%)	Gaps:	5/82 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   603 CD--KCGKTFKVKAQYKSHLKTRHTDYKPYKC--HLCPKEYPYRESLLTHMTVHTGIKRFLCNNC 663
            ||  .|.|.:...:..|:||:| ||..|||||  ..|...:...:.|..|...|||.|.|.|..|
Mouse   364 CDYNGCTKVYTKSSHLKAHLRT-HTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCMVC 427

  Fly   664 GKRFTCISNLQAHRKVH 680
            .:.|:...:|..|.|.|
Mouse   428 QRSFSRSDHLALHMKRH 444

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
zf30C	NP_477301.1	C2H2 Zn finger	33..53	CDD:275368
		C2H2 Zn finger	61..82	CDD:275368
		C2H2 Zn finger	98..117	CDD:275368
		C2H2 Zn finger	134..152	CDD:275368
		C2H2 Zn finger	511..532	CDD:275370
		COG5048	<523..>672	CDD:227381	26/72 (36%)
		C2H2 Zn finger	546..566	CDD:275368
		C2H2 Zn finger	575..595	CDD:275368
		C2H2 Zn finger	603..624	CDD:275368	8/22 (36%)
		C2H2 Zn finger	632..652	CDD:275368	4/21 (19%)
		C2H2 Zn finger	660..680	CDD:275368	6/19 (32%)
Klf5	NP_033899.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..22
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	50..69
		9aaTAD. /evidence=ECO:0000250\|UniProtKB:Q13887	107..115
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	284..310
		Interaction with WWP1. /evidence=ECO:0000250	313..317
		COG5048	338..>422	CDD:227381	22/58 (38%)
		C2H2 Zn finger	367..386	CDD:275368	6/19 (32%)
		zf-H2C2_2	378..>395	CDD:290200	10/17 (59%)
		C2H2 Zn finger	394..416	CDD:275368	4/21 (19%)
		zf-H2C2_2	408..433	CDD:290200	10/24 (42%)
		C2H2 Zn finger	424..444	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E33208_3BRQ6
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900