DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP96A15

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_176086.1 Gene:CYP96A15 / 842150 AraportID:AT1G57750 Length:497 Species:Arabidopsis thaliana


Alignment Length:600 Identity:130/600 - (21%)
Similarity:238/600 - (39%) Gaps:182/600 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAVLALLVLPLITLV-----YFERKASQRRQLLKEFNGPTPVPILGNANRIGKNPAEILSTFFDW 62
            :|:|...|..:..||     :|.:|..|.:.:||  |.|....:.|..::|.:        .:||
plant     1 MAMLGFYVTFIFFLVCLFTYFFLQKKPQGQPILK--NWPFLRMLPGMLHQIPR--------IYDW 55

  Fly    63 WYD-YGKDNFLF-----WIGYSSHIVMTNPKQLEYILNSQ-----QLIQKSTIYDLLHPWLGHGL 116
            ..: ....|..|     |:..:..:...:|:.:.:||:|.     :..:...|:|:    ||.|:
plant    56 TVEVLEATNLTFYFKGPWLSGTDMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDV----LGEGI 116

  Fly   117 LTSFGSKWHKHRKMITPSFHFNILQDFHEV-MNENSAK----FMTQLKKASAGDTIIDFQEHANY 176
            ||.....|.:.||.....||   .|||.|: ::.|.:|    .:..|..|:..:.||:.|:    
plant   117 LTVDFELWEEMRKSNHALFH---NQDFIELSVSSNKSKLKEGLVPFLDNAAQKNIIIELQD---- 174

  Fly   177 LTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLK 241
                                    :.|.|.....:|.|..:.|...|  :..|..||..      
plant   175 ------------------------VFQRFMFDTSSILMTGYDPMSLS--IEMLEVEFGE------ 207

  Fly   242 TLQDFTYDIIEKRVY----------ALQN----GGSKEDHDPSLPRKKMAFLDTLLSSTIDGR-- 290
                 ..||.|:.:|          .|||    |..::      .|..:|.::.:.:..|..|  
plant   208 -----AADIGEEAIYYRHFKPVILWRLQNWIGIGLERK------MRTALATVNRMFAKIISSRRK 261

  Fly   291 ---------PLTRQEI--YEEVSTFMFE--------------------GHDTTTSGVSFSVYLLS 324
                     |.::..:  |..|.|..::                    |.|||:|.:::..:|||
plant   262 EEISRAKTEPYSKDALTYYMNVDTSKYKLLKPNKDKFIRDVIFSLVLAGRDTTSSVLTWFFWLLS 326

  Fly   325 RHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDK-DYDIN 388
            :||.|..||        .|::|.....:::.|:.||...:.|:.|:||.:||..:...| |...:
plant   327 KHPQVMAKL--------RHEINTKFDNEDLEKLVYLHAALSESMRLYPPLPFNHKSPAKPDVLPS 383

  Fly   389 GSIVPKGTTLNLALILLGYNDRIF-KDPHHFRPERFEEE------KPAPFEYLPFSAGPRNCIGQ 446
            |..|...:.:.:.:..||....:: :|...|:|||:..:      :|: ::::.|::|||.|:|:
plant   384 GHKVDANSKIVICIYALGRMRSVWGEDALDFKPERWISDNGGLRHEPS-YKFMAFNSGPRTCLGK 447

  Fly   447 KFALLELKTVISKVVRS--FEVLPAVDELVSTDGRLNTYLGLAPDEKLKREAGRHKYDPILSAVL 509
            ..|||::|.|..:::|:  |:|:..                             ||.:||.|.:|
plant   448 NLALLQMKMVALEIIRNYDFKVIEG-----------------------------HKVEPIPSILL 483

  Fly   510 TLKSDNGLHLRLRER 524
            .:|  :||.:.:.::
plant   484 RMK--HGLKVTVTKK 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 110/505 (22%)
CYP96A15NP_176086.1 PLN02169 1..497 CDD:177826 130/599 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H111093
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.