DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP72C1

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:125 Identity:35/125 - (28%)
Similarity:64/125 - (51%) Gaps:4/125 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YGKDNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLHPWLGHGLLTSFGSKWHKHRKM 130
            :||..|. |.|...::::.:|:.|..|::..:|..|..|....|.:|. |||...|.||.|||.:
plant    94 HGKKCFT-WYGPYPNVIVMDPETLREIMSKHELFPKPKIGSHNHVFLS-GLLNHEGPKWSKHRSI 156

  Fly   131 ITPSFHFNILQDFHEVMNENSAKFMTQLKK-ASAGDTI-IDFQEHANYLTLDVICDTAMG 188
            :.|:|..:.|:......|.:..:.:.:.:: |||..|: :|...|.:.||.:::...:.|
plant   157 LNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTMELDSWTHCHDLTRNMLARASFG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 35/125 (28%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.