DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP87A2

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001184974.1 Gene:CYP87A2 / 837830 AraportID:AT1G12740 Length:478 Species:Arabidopsis thaliana


Alignment Length:578 Identity:115/578 - (19%)
Similarity:211/578 - (36%) Gaps:154/578 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MW--LAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNA------------------ 45
            ||  |..::||::.:...||..|....|.:|..   |....|:||.:                  
plant     1 MWALLIWVSLLLISITHWVYSWRNPKCRGKLPP---GSMGFPLLGESIQFFKPNKTSDIPPFIKE 62

  Fly    46 -----------------NRIGKNPAEILSTFFDW-WYDYGKDNFLFWIGYSSHIVMTNPKQLEYI 92
                             |.:|: |. |:||..|. ::.:.::...|...|        |....:|
plant    63 RVKNDVDMCRYGPIFKTNLVGR-PV-IVSTDADLSYFVFNQEGRCFQSWY--------PDTFTHI 117

  Fly    93 LNSQQLIQKSTIYDLLHPWLGHGLLTSFGSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQ 157
            ...:.:   .:::..::.:|.:.:||.||   |...|.:.|.......:......|::|    .:
plant   118 FGKKNV---GSLHGFMYKYLKNMVLTLFG---HDGLKKMLPQVEMTANKRLELWSNQDS----VE 172

  Fly   158 LKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRA-FHPFK 221
            ||.|:|                .:|.|......|:....:.|.            |:|| |..|.
plant   173 LKDATA----------------SMIFDLTAKKLISHDPDKSSE------------NLRANFVAFI 209

  Fly   222 RSNRVFSLTPEFSAYQKTL----KTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMA-FLDT 281
            :....|......:||.|.|    |.::.....:.|:|    :|           |||..: |.|.
plant   210 QGLISFPFDIPGTAYHKCLQGRAKAMKMLRNMLQERR----EN-----------PRKNPSDFFDY 259

  Fly   282 LLSS-TIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGH-- 343
            ::.. ..:|..||.:...:.:...:|...:||:..::.::..||..|:|.::|..|...::.:  
plant   260 VIEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNRE 324

  Fly   344 DMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYN 408
            |.:..::::|...|.|...||.|..|:...||.|.|...:|.......:|.|..:.:....:..|
plant   325 DADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALRDIKFKDYTIPAGWAVMVCPPAVHLN 389

  Fly   409 DRIFKDPHHFRPERFEEEK--PAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVD 471
            ..::|||..|.|.|:|..|  .|...::.|..|.|.|:|..|..|::...:..:|.         
plant   390 PEMYKDPLVFNPSRWEGSKVTNASKHFMAFGGGMRFCVGTDFTKLQMAAFLHSLVT--------- 445

  Fly   472 ELVSTDGRLNTYLGLAPDEKLKREAGRHKYDPILSAVLT----LKSDNGLHLRLRERR 525
                                      :::::.|....:|    |:..||.|::|.::|
plant   446 --------------------------KYRWEEIKGGNITRTPGLQFPNGYHVKLHKKR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 97/479 (20%)
CYP87A2NP_001184974.1 p450 4..475 CDD:299894 112/571 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.