DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP714A2

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_197872.1 Gene:CYP714A2 / 832559 AraportID:AT5G24900 Length:525 Species:Arabidopsis thaliana


Alignment Length:512 Identity:124/512 - (24%)
Similarity:222/512 - (43%) Gaps:77/512 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVLALLVLPLITLVY-------FERKASQRRQLLKEFNGPTPVPILGNA---------------- 45
            |:..::::.:.::.|       .|:...:|...|:...||.|....||.                
plant    11 AIWCIVIVGIFSVGYHVYGRAVVEQWRMRRSLKLQGVKGPPPSIFNGNVSEMQRIQSEAKHCSGD 75

  Fly    46 NRIGKNPAEILSTFFDWW-YDYGKDNFLFWIGYSSHIVMTNPKQLEYI--LNSQQLIQKSTIYDL 107
            |.|..:.:..|...||.| ..||: .:.:..|...|:.:.:|:.::.:  .|:..|.:.:.|...
plant    76 NIISHDYSSSLFPHFDHWRKQYGR-IYTYSTGLKQHLYINHPEMVKELSQTNTLNLGRITHITKR 139

  Fly   108 LHPWLGHGLLTSFGSKWHKHRKMITPSFHFNILQDFHEVMNENSA----KFMTQLKKASAGDTII 168
            |:|.||:|::||.|..|...|::|...|..:.::....:|.|::.    |:...:|:.......|
plant   140 LNPILGNGIITSNGPHWAHQRRIIAYEFTHDKIKGMVGLMVESAMPMLNKWEEMVKRGGEMGCDI 204

  Fly   169 DFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRA----FHPFKRSNRVF-- 227
            ...|....::.|||.....|...:    :..:|....||:...|..|:    |:.|  ::.||  
plant   205 RVDEDLKDVSADVIAKACFGSSFS----KGKAIFSMIRDLLTAITKRSVLFRFNGF--TDMVFGS 263

  Fly   228 ---------SLTPEF-SAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTL 282
                     :|..|. |:..:|:|..:....|..:|.:..|...|:....|.:| ..|.|:    
plant   264 KKHGDVDIDALEMELESSIWETVKEREIECKDTHKKDLMQLILEGAMRSCDGNL-WDKSAY---- 323

  Fly   283 LSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNR 347
                       |:.:.:...:..|.|||:|...||:.:.||:.:|..|.|:   :.|::....|.
plant   324 -----------RRFVVDNCKSIYFAGHDSTAVSVSWCLMLLALNPSWQVKI---RDEILSSCKNG 374

  Fly   348 SVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYNDRIF 412
            ....:.|..:|.:.:.|:|..|:||..|.:||...||..:...:||||..:...:..|..:..|:
plant   375 IPDAESIPNLKTVTMVIQETMRLYPPAPIVGREASKDIRLGDLVVPKGVCIWTLIPALHRDPEIW 439

  Fly   413 -KDPHHFRPERFEE--EKPA--PFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSF 464
             .|.:.|:||||.|  .|..  |..|:||..|||.|:|:.|.::|:|.::|.:|..|
plant   440 GPDANDFKPERFSEGISKACKYPQSYIPFGLGPRTCVGKNFGMMEVKVLVSLIVSKF 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 119/474 (25%)
CYP714A2NP_197872.1 p450 37..524 CDD:299894 121/486 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 160 1.000 Domainoid score I1269
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.