DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP86A2

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_191946.1 Gene:CYP86A2 / 828019 AraportID:AT4G00360 Length:553 Species:Arabidopsis thaliana


Alignment Length:572 Identity:133/572 - (23%)
Similarity:226/572 - (39%) Gaps:142/572 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYFERKASQRRQLLKEFNGPTPVPILGNANRIGKNPAEILSTFFDWWYDYGKDNFLFWIG-YSSH 80
            ::|:|       :.:...||...|:||:.      |..|...  |..:|:..:|.....| |.:.
plant    18 LWFQR-------ISRWLKGPRVWPVLGSL------PGLIEQR--DRMHDWITENLRACGGTYQTC 67

  Fly    81 I--------------VMTNPKQLEYILNSQ--QLIQKSTIYDLLHPWLGHGLLTSFGSKWHKHRK 129
            |              |..:||.:|::|.::  ...:..|...:.|.:||.|:..|.|..|...||
plant    68 ICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIFNSDGDTWLFQRK 132

  Fly   130 MITPSFHFNIL-QDFHEVMNEN-SAKFMTQLKKASAGDTIIDFQEHANYLTLDVIC------DT- 185
            .....|....| |.....:|.. ..:|...|:.|......:|.|:....||.|.||      || 
plant   133 TAALEFTTRTLRQAMGRWVNRGIKLRFCPILETAQNNYEPVDLQDLILRLTFDNICGLAFGKDTR 197

  Fly   186 --AMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPEF-------------SA 235
              |.|:|       ::....|| |.....:::.|           :.|||             .:
plant   198 TCAPGLP-------ENGFASAF-DRATEASLQRF-----------ILPEFLWRLKKWLGLGLEVS 243

  Fly   236 YQKTLKTLQDFTYDIIEKRVYAL--QNGGSKEDHDPSLPR----KKMAFLDTLLSSTIDGRPLTR 294
            ..::|..:..:...:|..|...|  |.....:.||..|.|    |..::.:|.|...        
plant   244 LSRSLGEIDGYLDAVINTRKQELLSQRESGVQRHDDLLSRFMKKKDQSYSETFLRHV-------- 300

  Fly   295 QEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVM----GHDMN----RSVSF 351
                  ...|:..|.||::..:|:..:|::.||.|:.|:.||.|.|:    |.|::    ..:.|
plant   301 ------ALNFILAGRDTSSVALSWFFWLITTHPTVEDKIVREICSVLIETRGTDVSSWTAEPLEF 359

  Fly   352 QEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDI--NGSIVPKGTTLNLALILLGYNDRIF-K 413
            .|:.::.||...:.|..|:|||||...::...| ||  :|:.||.|:::..::...|.....: :
plant   360 DEVDRLVYLKAALSETLRLYPSVPEDSKHVVND-DILPDGTFVPAGSSVTYSIYAAGRMKSTWGE 423

  Fly   414 DPHHFRPERFEEEKPAPF------EYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDE 472
            |...|:|||:.......|      .::.|:||||.|:|:..|.|::||:.:.|:           
plant   424 DCLEFKPERWISPDDGKFVNHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVL----------- 477

  Fly   473 LVSTDGRLNTYLGLAPDEKLKREAGRHKYDPILSAVLTLKSDNGLHLRLRER 524
                   |...|.:||..|::::..           |||...|||.:.:.:|
plant   478 -------LRHRLTVAPGHKVEQKMS-----------LTLFMKNGLLVNVHKR 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 119/496 (24%)
CYP86A2NP_191946.1 CYP86A 67..504 CDD:410687 116/499 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.