DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP702A6

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_680696.2 Gene:CYP702A6 / 827207 AraportID:AT4G15396 Length:475 Species:Arabidopsis thaliana


Alignment Length:505 Identity:104/505 - (20%)
Similarity:192/505 - (38%) Gaps:115/505 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WLAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTP-----VPILGNANRIGK-NPAEILSTF- 59
            |..:::|:|:.|...:|..|....        ||..|     .||:|......| :.|..|.|| 
plant     8 WAVIVSLIVVKLCHSIYQWRNPKS--------NGELPPGSMGYPIIGETFEFMKPHDAIQLPTFV 64

  Fly    60 ----------FDWWYDYGKDNFLFWIGYSSHIVMTN-----PKQLEYILNSQQL-IQKSTIYDLL 108
                      |......||......||.:..|..||     ||.|..:..:..| :.|.|     
plant    65 KEKVLRHGPVFRTSLFGGKVIISTDIGLNMEIAKTNHIPGMPKSLARLFGANNLFVNKDT----- 124

  Fly   109 HPWLGHGLLTSFGSKWHKHRKMITPSF------HFNILQDFHEVMNENSAKFMTQLKKASAGDTI 167
                            |||.:.:|..|      ...:|||...::.       |.||:.:...: 
plant   125 ----------------HKHARSLTNQFLGSQALKLRMLQDIDFLVR-------THLKEGARKGS- 165

  Fly   168 IDFQEHANYLTLDVICDTAMG--VPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLT 230
            :|.:|..:.:.::.:....||  .|..|.|          ..:|:....|.:..|..:.....:.
plant   166 LDIKETTSKIIIECLAKKVMGEMEPDAAKE----------LTLCWTFFPREWFGFAWNIPGTGVY 220

  Fly   231 PEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDG-RPLTR 294
            ....|..:.:|.|::   .:::||....:.|.               |..|:...|..| :.::.
plant   221 RMVKARNRMMKVLKE---TVLKKRASGEELGD---------------FFKTIFGDTERGVKTISL 267

  Fly   295 QEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRS----VSFQEIA 355
            :...|.:.|.....::||.:.::.::.|:|.||.|.::|.||...::...:.::    :::::..
plant   268 ESATEYIFTLFLLANETTPAVLAATIKLISDHPKVMQELQREHEGIVRDKIEKNEKADLTWEDYK 332

  Fly   356 KMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGY-----NDRIFKDP 415
            .|.:..:.|.|:.|:..:||.:.|..|.::......:|.|      .|.:||     |...:.||
plant   333 SMTFTQMVINESLRITSTVPTVLRIIDHEFQFGEYTIPAG------WIFMGYPYVHFNAEKYDDP 391

  Fly   416 HHFRPERFEEEKPAPF---EYLPFSAGPRNCIGQKFALLELKTVISKVVR 462
            ..|.|.|::.:..:..   .|:||.:|.|.|:|.:|..|::...|..:.|
plant   392 LAFNPWRWKGKDLSAIVSRTYIPFGSGSRLCVGAEFVKLKMAIFIHHLSR 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 97/472 (21%)
CYP702A6NP_680696.2 p450 9..454 CDD:299894 103/504 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.