DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e3 and CYP702A5

DIOPT Version :9

Sequence 1:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001078393.1 Gene:CYP702A5 / 827206 AraportID:AT4G15393 Length:467 Species:Arabidopsis thaliana


Alignment Length:528 Identity:107/528 - (20%)
Similarity:190/528 - (35%) Gaps:163/528 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WLAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTP-----VPILGNANRIGK-NPAEILSTF- 59
            |..:::|:|:.|...:|..:.        .:.||..|     .||:|......| :.|..|.|| 
plant     8 WAVIVSLIVVKLCHWIYQWKN--------PKGNGKLPPGSMGYPIIGETFEFMKLHDAIQLPTFV 64

  Fly    60 ----------FDWWYDYGKDNFLFWIGYSSHIVMTN-----PKQLEYILNSQQL-IQKSTIYDLL 108
                      |......||......||.:..|..||     ||.||.:..:..| :.|.|     
plant    65 KEKLLRHGPVFRTSLFGGKVIISTDIGLNMEIAKTNHIPGMPKSLERLFGATNLFVNKDT----- 124

  Fly   109 HPWLGHGLLTSFGSKWHKHRKMITPSF------HFNILQDFHEVMNENSAKFMTQL-KKASAGDT 166
                            |||.:.:|..|      ...::||.         .|:.:. .|..|...
plant   125 ----------------HKHARSLTNQFLGSQALKLRMIQDI---------DFLARTHMKEGARKG 164

  Fly   167 IIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAFRD--MCYNINMRAFHPF--------- 220
            .:|.:|.|:.:.::.:....||    .||.      :|.::  :|:....|.:..|         
plant   165 CLDVKETASKIVIECLSKKVMG----EMEP------EAAKELTLCWTFFPRDWFRFAWNFPGTGV 219

  Fly   221 ----KRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMA-FLD 280
                |..||:..:..|                .:::||...                ||:. |.:
plant   220 YRIVKARNRMMKVIKE----------------TVVKKRASG----------------KKLGEFFE 252

  Fly   281 TLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQ----CEVM 341
            |:...| :...::.:...|.:.|.....::||...::.::.|:|.:|.|.::|.||.    .:.:
plant   253 TIFGDT-ESVTMSIEIATEYIFTLFVLANETTPGVLAATIKLISDNPKVMQELRREHEGIVQDKI 316

  Fly   342 GHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLG 406
            ..|....:::::...|.:..:.|.|:.|:..:||.:.|..|.:.......:|.|      .|.:|
plant   317 KKDETADLTWEDYKSMTFTQMVINESLRITSTVPTVLRIIDHEIQFGDYTIPAG------WIFMG 375

  Fly   407 YNDRIFKDPH-HFRPERFEEEKPAPFE----------------YLPFSAGPRNCIGQKFALLELK 454
            |       |: ||.||::::  |..|.                ||||.:|.|.|:|.:|..|::.
plant   376 Y-------PYVHFNPEKYDD--PLAFNPWRWKGKDLSTIVSKTYLPFGSGTRLCVGAEFVKLQMA 431

  Fly   455 TVISKVVR 462
            ..|..:.|
plant   432 IFIHHLFR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 101/495 (20%)
CYP702A5NP_001078393.1 p450 30..448 CDD:386267 102/498 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.